Metadata-Version: 2.1
Name: CodonTransformer
Version: 1.5.2
Summary: The ultimate tool for codon optimization, transforming protein sequences into optimized DNA sequences specific for your target organisms.
Home-page: https://github.com/adibvafa/CodonTransformer
Author: Adibvafa Fallahpour
Author-email: Adibvafa.fallahpour@mail.utoronto.ca
Classifier: Programming Language :: Python :: 3
Classifier: License :: OSI Approved :: Apache Software License
Classifier: Operating System :: OS Independent
Requires-Python: >=3.9
Description-Content-Type: text/markdown
License-File: LICENSE
Requires-Dist: biopython<2.0,>=1.83
Requires-Dist: ipywidgets<10.0,>=7.0.0
Requires-Dist: numpy<3.0,>=1.26.4
Requires-Dist: onnxruntime<3.0,>=1.17.3
Requires-Dist: pandas<3.0,>=2.0.0
Requires-Dist: python_codon_tables<1.0,>=0.1.12
Requires-Dist: pytorch_lightning<3.0,>=2.2.1
Requires-Dist: scipy<3.0,>=1.13.1
Requires-Dist: setuptools<70.0,>=68.2.2
Requires-Dist: torch<3.0,>=2.0.0
Requires-Dist: tqdm<5.0,>=4.66.2
Requires-Dist: transformers<5.0,>=4.40.0
Requires-Dist: CAI-PyPI<3.0,>=2.0.1

<p align="center">
  <img src="https://github.com/Adibvafa/CodonTransformer/raw/main/src/banner_final.png" alt="CodonTransformer Logo" width="100%" height="100%" style="vertical-align: middle;"/>
</p>

<p align="center">
    <a href="https://adibvafa.github.io/CodonTransformer/"><img alt="Documentation" src="https://img.shields.io/website/http/adibvafa.github.io/CodonTransformer/index.svg?color=00B89E&down_color=red&down_message=offline&up_message=online"></a>
    <a href="https://github.com/adibvafa/CodonTransformer/blob/main/LICENSE"><img alt="GitHub" src="https://img.shields.io/github/license/adibvafa/CodonTransformer.svg?color=E80070"></a>
    <a href="https://github.com/adibvafa/CodonTransformer/releases"><img alt="GitHub release" src="https://img.shields.io/github/release/adibvafa/CodonTransformer.svg?color=00BEE8"></a>
    <a href="https://pypi.org/project/CodonTransformer/"><img alt="PyPI" src="https://img.shields.io/pypi/v/CodonTransformer?color=E8C800"></a>
    <a href="https://doi.org/10.1101/2024.09.13.612903"><img src="http://img.shields.io/badge/DOI-10.1101/2024.09.13.612903-000080.svg" alt="DOI"></a>
</p>

## Table of Contents
- [Overview](#overview)
- [Use Case](#use-case)
- [Installation](#installation)
- [Finetuning](#finetuning-codontransformer)
- [Key Features](#key-features)
  - [CodonData](#codondata)
  - [CodonPrediction](#codonprediction)
  - [CodonEvaluation](#codonevaluation)
  - [CodonUtils](#codonutils)
  - [CodonJupyter](#codonjupyter)
- [Contribution](#contribution)
- [Citation](#citation)
<br></br>

## Abstract
The genetic code is degenerate allowing a multitude of possible DNA sequences to encode the same protein. This degeneracy impacts the efficiency of heterologous protein production due to the codon usage preferences of each organism. The process of tailoring organism-specific synonymous codons, known as codon optimization, must respect local sequence patterns that go beyond global codon preferences. As a result, the search space faces a combinatorial explosion that makes exhaustive exploration impossible. Nevertheless, throughout the diverse life on Earth, natural selection has already optimized the sequences, thereby providing a rich source of data allowing machine learning algorithms to explore the underlying rules. Here, we introduce CodonTransformer, a multispecies deep learning model trained on over 1 million DNA-protein pairs from 164 organisms spanning all kingdoms of life. The model demonstrates context-awareness thanks to the attention mechanism and bidirectionality of the Transformers we used, and to a novel sequence representation that combines organism, amino acid, and codon encodings. CodonTransformer generates host-specific DNA sequences with natural-like codon distribution profiles and with negative cis-regulatory elements. This work introduces a novel strategy of Shared Token Representation and Encoding with Aligned Multi-masking (STREAM) and provides a state-of-the-art codon optimization framework with a customizable open-access model and a user-friendly interface.
<br></br>


## Use Case
**For an interactive demo, check out our [Google Colab Notebook.](https://adibvafa.github.io/CodonTransformer/GoogleColab)**
<br></br>
After installing CodonTransformer, you can use:
```python
import torch
from transformers import AutoTokenizer, BigBirdForMaskedLM
from CodonTransformer.CodonPrediction import predict_dna_sequence
from CodonTransformer.CodonJupyter import format_model_output
DEVICE = torch.device("cuda" if torch.cuda.is_available() else "cpu")


# Load model and tokenizer
tokenizer = AutoTokenizer.from_pretrained("adibvafa/CodonTransformer")
model = BigBirdForMaskedLM.from_pretrained("adibvafa/CodonTransformer").to(DEVICE)


# Set your input data
protein = "MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGG"
organism = "Escherichia coli general"


# Predict with CodonTransformer
output = predict_dna_sequence(
    protein=protein,
    organism=organism,
    device=DEVICE,
    tokenizer=tokenizer,
    model=model,
    attention_type="original_full",
)
print(format_model_output(output))
```
The output is:
```
-----------------------------
|          Organism         |
-----------------------------
Escherichia coli general

-----------------------------
|       Input Protein       |
-----------------------------
MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAEDLQVGQVELGG

-----------------------------
|      Processed Input      |
-----------------------------
M_UNK A_UNK L_UNK W_UNK M_UNK R_UNK L_UNK L_UNK P_UNK L_UNK L_UNK A_UNK L_UNK L_UNK A_UNK L_UNK W_UNK G_UNK P_UNK D_UNK P_UNK A_UNK A_UNK A_UNK F_UNK V_UNK N_UNK Q_UNK H_UNK L_UNK C_UNK G_UNK S_UNK H_UNK L_UNK V_UNK E_UNK A_UNK L_UNK Y_UNK L_UNK V_UNK C_UNK G_UNK E_UNK R_UNK G_UNK F_UNK F_UNK Y_UNK T_UNK P_UNK K_UNK T_UNK R_UNK R_UNK E_UNK A_UNK E_UNK D_UNK L_UNK Q_UNK V_UNK G_UNK Q_UNK V_UNK E_UNK L_UNK G_UNK G_UNK __UNK

-----------------------------
|       Predicted DNA       |
-----------------------------
ATGGCTTTATGGATGCGTCTGCTGCCGCTGCTGGCGCTGCTGGCGCTGTGGGGCCCGGACCCGGCGGCGGCGTTTGTGAATCAGCACCTGTGCGGCAGCCACCTGGTGGAAGCGCTGTATCTGGTGTGCGGTGAGCGCGGCTTCTTCTACACGCCCAAAACCCGCCGCGAAGCGGAAGATCTGCAGGTGGGCCAGGTGGAGCTGGGCGGCTAA
```
<br>

**You can use the [inference template](https://github.com/Adibvafa/CodonTransformer/raw/main/src/CodonTransformer_inference_template.xlsx) for batch inference in [Google Colab](https://adibvafa.github.io/CodonTransformer/GoogleColab).**

<br>


## Installation
Install CodonTransformer via pip:

```sh
pip install CodonTransformer
```

Or clone the repository:

```sh
git clone https://github.com/adibvafa/CodonTransformer.git
cd CodonTransformer
pip install -r requirements.txt
```

The package requires `python>=3.9`. The requirements are [availabe here](requirements.txt).
<br><br><br>


## Finetuning CodonTransformer
To finetune CodonTransformer on your own data, follow these steps:

1. **Prepare your dataset**
   
   Create a CSV file with the following columns:
   - `dna`: DNA sequences (string, preferably uppercase ATCG)
   - `protein`: Protein sequences (string, preferably uppercase amino acid letters)
   - `organism`: Target organism (string or int, must be from `ORGANISM2ID` in `CodonUtils`)


   Note: 
   - Use organisms from the `FINE_TUNE_ORGANISMS` list for best results.
   - For E. coli, use `Escherichia coli general`.
   - DNA sequences should ideally contain only A, T, C, and G. Ambiguous codons are replaced with 'UNK' for tokenization.
   - Protein sequences should contain standard amino acid letters from `AMINO_ACIDS` in `CodonUtils`. Ambiguous amino acids are replaced according to the `AMBIGUOUS_AMINOACID_MAP` in `CodonUtils`.
   - End your DNA sequences with a stop codon from `STOP_CODONS` in `CodonUtils`. If not present, a 'UNK' stop codon will be addded in preprocessing.
   - End your protein sequence with `_` or `*`. If either is not present, a `_` will be added in preprocessing.
<br>

2. **Prepare training data**
   
   Use the `prepare_training_data` function from `CodonData` to prepare training data from your dataset.

   ```python
   from CodonTransformer.CodonData import prepare_training_data
   prepare_training_data('your_data.csv', 'your_dataset_directory/training_data.json')
   ```
<br>

3. **Run the finetuning script**
   
   Execute finetune.py with appropriate arguments:
    ```bash
     python finetune.py \
        --dataset_dir 'your_dataset_directory/training_data.json' \
        --checkpoint_dir 'your_checkpoint_directory' \
        --checkpoint_filename 'finetune.ckpt' \
        --batch_size 6 \
        --max_epochs 15 \
        --num_workers 5 \
        --accumulate_grad_batches 1 \
        --num_gpus 4 \
        --learning_rate 0.00005 \
        --warmup_fraction 0.1 \
        --save_every_n_steps 512 \
        --seed 123
    ```
   This script automatically loads the pretrained model from Hugging Face and finetunes it on your dataset.
   For an example of a SLURM job request, see the `slurm` directory in the repository.
<br></br>


## Key Features
- **CodonData** <br>
For preprocessing NCBI or Kazusa databases and preparing the data for training and inference of models. Includes functions for working with DNA sequences, protein sequences, and codon frequencies.

- **CodonPrediction** <br>
For tokenizing input, loading models, predicting DNA sequences, and providing helper functions for data processing. Includes tools for working with the BigBird transformer model, tokenization, and various codon optimization strategies.

- **CodonEvaluation** <br>
For calculating evaluation metrics related to codon usage and DNA sequence analysis. Enables in-depth analysis and comparison of DNA sequences across different organisms.

- **CodonUtils** <br>
Contains constants and helper functions for working with genetic sequences, amino acids, and organism data. Provides robust tools for genetic sequence analysis and data processing.

- **CodonJupyter** <br>
Offers Jupyter-specific functions for displaying interactive widgets, enhancing user interaction with the CodonTransformer package in a Jupyter notebook environment. Provides interactive and visually appealing interfaces for input and output.
<br></br>


## CodonData

The CodonData subpackage offers tools for preprocessing NCBI or Kazusa databases and managing codon-related data operations. It includes comprehensive functions for working with DNA sequences, protein sequences, and codon frequencies, providing a robust toolkit for sequence preprocessing and codon frequency analysis across different organisms.

### Overview

This subpackage is suitable for:

- Preparing data for model training and inference
- Preprocessing and cleaning DNA and protein sequences
- Translating DNA sequences to protein sequences
- Reading and processing FASTA files
- Downloading and processing codon frequency data from the Kazusa database
- Calculating codon frequencies from given sequences
- Handling organism-specific codon tables and translations

### Available Functions

- `prepare_training_data(dataset: Union[str, pd.DataFrame], output_file: str, shuffle: bool = True) -> None`

  Prepare a JSON dataset for training the CodonTransformer model. Process the input dataset, create the 'codons' column, handle organism IDs, and save the result to a JSON file.

- `dataframe_to_json(df: pd.DataFrame, output_file: str, shuffle: bool = True) -> None`

  Convert a pandas DataFrame to a JSON file format suitable for training CodonTransformer. Write each row of the DataFrame as a JSON object to the output file, with an option to shuffle the data.

- `process_organism(organism: Union[str, int], organism_to_id: Dict[str, int]) -> int`

  Process and validate the organism input, converting it to a valid organism ID. Handle both string (organism name) and integer (organism ID) inputs.

- `get_codon_table(organism: str) -> int`

  Return the appropriate NCBI codon table number for a given organism.

- `preprocess_protein_sequence(protein: str) -> str`

  Clean, standardize, and handle ambiguous amino acids in a protein sequence.

- `replace_ambiguous_codons(dna: str) -> str`

  Replace ambiguous codons in a DNA sequence with "UNK".

- `preprocess_dna_sequence(dna: str) -> str`

  Clean and preprocess a DNA sequence by standardizing it and replacing ambiguous codons.

- `get_merged_seq(protein: str, dna: str = "", separator: str = "_") -> str`

  Merge protein and DNA sequences into a single string of tokens.

- `is_correct_seq(dna: str, protein: str, stop_symbol: str = STOP_SYMBOL) -> bool`

  Check if the given DNA and protein pair is correct based on specific criteria.

- `get_amino_acid_sequence(dna: str, stop_symbol: str = "_", codon_table: int = 1, return_correct_seq: bool = True) -> Union[Tuple[str, bool], str]`

  Translate a DNA sequence to a protein sequence using a specified codon table.

- `read_fasta_file(input_file: str, output_path: str, organism: str = "", return_dataframe: bool = True, buffer_size: int = 50000) -> pd.DataFrame`

  Read a FASTA file of DNA sequences and saves it to a Pandas DataFrame.

- `download_codon_frequencies_from_kazusa(taxonomy_id: Optional[int] = None, organism: Optional[str] = None, taxonomy_reference: Optional[str] = None, return_original_format: bool = False) -> AMINO2CODON_TYPE`

  Download and process codon frequency data from the Kazusa database for a given taxonomy ID or organism.

- `build_amino2codon_skeleton(organism: str) -> AMINO2CODON_TYPE`

  Create an empty skeleton of the amino2codon dictionary for a given organism.

- `get_codon_frequencies(dna_sequences: List[str], protein_sequences: Optional[List[str]] = None, organism: Optional[str] = None) -> AMINO2CODON_TYPE`

  Calculate codon frequencies based on a collection of DNA and protein sequences.

- `get_organism_to_codon_frequencies(dataset: pd.DataFrame, organisms: List[str]) -> Dict[str, AMINO2CODON_TYPE]`

  Generate a dictionary mapping each organism to its codon frequency distribution.
<br></br>


## CodonPrediction

The CodonPrediction subpackage is an essential component of CodonTransformer, used for tokenizing input, loading models, predicting DNA sequences, and providing helper functions for data processing. It offers a comprehensive toolkit for working with the CodonTransformer model, covering tasks from model loading and configuration to various types of codon optimization and DNA sequence prediction.

### Overview

This subpackage contains functions and classes that handle the core prediction functionality of CodonTransformer. It includes tools for working with the BigBird transformer model, tokenization, and various codon optimization strategies.

### Available Functions and Classes

- `predict_dna_sequence(protein: str, organism: Union[int, str], device: torch.device, tokenizer: Union[str, PreTrainedTokenizerFast], model: Union[str, torch.nn.Module], attention_type: str = "original_full") -> DNASequencePrediction`

  Predict the DNA sequence for a given protein using the CodonTransformer model.

- `load_model(path: str, device: torch.device = None, num_organisms: int = None, remove_prefix: bool = True, attention_type: str = "original_full") -> torch.nn.Module`

  Load a BigBirdForMaskedLM model from a file or checkpoint.

- `load_bigbird_config(num_organisms: int) -> BigBirdConfig`

  Load the configuration object used to train the BigBird transformer.

- `create_model_from_checkpoint(checkpoint_dir: str, output_model_dir: str, num_organisms: int) -> None`

  Save a model to disk using a previous checkpoint.

- `load_tokenizer(tokenizer_path: str) -> PreTrainedTokenizerFast`

  Create and return a tokenizer object from the given tokenizer path.

- `tokenize(batch: List[Dict[str, Any]], tokenizer_path: str = "", tokenizer_object: Optional[PreTrainedTokenizerFast] = None, max_len: int = 2048) -> BatchEncoding`

  Tokenize sequences given a batch of input data.

- `validate_and_convert_organism(organism: Union[int, str]) -> Tuple[int, str]`

  Validate and convert the organism input to both ID and name.

- `get_high_frequency_choice_sequence(protein: str, codon_frequencies: Dict[str, Tuple[List[str], List[float]]]) -> str`

  Return a DNA sequence optimized using the High Frequency Choice (HFC) approach.

- `precompute_most_frequent_codons(codon_frequencies: Dict[str, Tuple[List[str], List[float]]]) -> Dict[str, str]`

  Precompute the most frequent codon for each amino acid.

- `get_high_frequency_choice_sequence_optimized(protein: str, codon_frequencies: Dict[str, Tuple[List[str], List[float]]]) -> str`

  An efficient implementation of the HFC approach, up to 10 times faster than the original.

- `get_background_frequency_choice_sequence(protein: str, codon_frequencies: Dict[str, Tuple[List[str], List[float]]]) -> str`

  Return a DNA sequence optimized using the Background Frequency Choice (BFC) approach.

- `precompute_cdf(codon_frequencies: Dict[str, Tuple[List[str], List[float]]]) -> Dict[str, Tuple[List[str], Any]]`

  Precompute the cumulative distribution function (CDF) for each amino acid.

- `get_background_frequency_choice_sequence_optimized(protein: str, codon_frequencies: Dict[str, Tuple[List[str], List[float]]]) -> str`

  An efficient implementation of the BFC approach, up to 8 times faster than the original.

- `get_uniform_random_choice_sequence(protein: str, codon_frequencies: Dict[str, Tuple[List[str], List[float]]]) -> str`

  Return a DNA sequence optimized using the Uniform Random Choice (URC) approach.

- `get_icor_prediction(input_seq: str, model_path: str, stop_symbol: str) -> str`

  Return an optimized codon sequence for the given protein sequence using ICOR (Improving Codon Optimization with Recurrent Neural Networks).
<br></br>


## CodonEvaluation

The CodonEvaluation subpackage offers functions for calculating evaluation metrics related to codon usage and DNA sequence analysis, used for assessing the quality and characteristics of DNA sequences, especially in codon optimization. It provides a comprehensive toolkit for evaluating DNA sequences and codon usage, performingng genetic data analysis within the CodonTransformer package.


### Overview

The CodonEvaluation module includes functions to compute metrics such as Codon Adaptation Index (CAI)/Codon Similarity Index (CSI) weights, GC content, codon frequency distribution (CFD), %MinMax, sequence complexity, and sequence similarity. These metrics are valuable for analyzing and comparing DNA sequences across different organisms.

### Available Functions

- `get_organism_to_CAI_weights(dataset: pd.DataFrame, organisms: List[str]) -> Dict[str, dict]`

  Calculate the Codon Adaptation Index (CAI) weights for a list of organisms.

- `get_GC_content(dna: str, lower: bool = False) -> float`

  Compute the GC content of a DNA sequence.

- `get_cfd(dna: str, codon_frequencies: Dict[str, Tuple[List[str], List[float]]], threshold: float = 0.3) -> float`

  Calculate the codon frequency distribution (CFD) metric for a DNA sequence.

- `get_cousin(dna: str, organism: str, ref_freq: AMINO2CODON_TYPE) -> float`

  Compute the cousin score between a DNA sequence and reference frequencies.

- `get_min_max_percentage(dna: str, codon_frequencies: Dict[str, Tuple[List[str], List[float]]], window_size: int = 18) -> List[float]`

  Calculate the %MinMax metric for a DNA sequence.

- `get_sequence_complexity(dna: str) -> float`

  Compute the sequence complexity score of a DNA sequence.

- `get_sequence_similarity(original: str, predicted: str, truncate: bool = True, window_length: int = 1) -> float`

  Calculate the sequence similarity between two sequences.
<br></br>


## CodonUtils

The CodonUtils subpackage contains constants and helper functions essential for working with genetic sequences, amino acids, and organism data in the CodonTransformer package. It provides tools for genetic sequence analysis, organism identification, and data processing, forming the foundation for many core functionalities within the CodonTransformer package.

### Contents

#### Constants

- `AMINO_ACIDS`: List of all standard amino acids
- `AMBIGUOUS_AMINOACID_MAP`: Mapping of ambiguous amino acids to standard amino acids
- `START_CODONS` and `STOP_CODONS`: Lists of start and stop codons
- `TOKEN2INDEX` and `INDEX2TOKEN`: Mappings between tokens and their indices
- `TOKEN2MASK`: Mapping for mask tokens
- `FINE_TUNE_ORGANISMS`: List of organisms used for fine-tuning
- `ORGANISM2ID`: Dictionary mapping organisms to their respective IDs
- `NUM_ORGANISMS`, `MAX_LEN`, `MAX_AMINO_ACIDS`, `STOP_SYMBOL`: Various constants for sequence processing

#### Classes

- `DNASequencePrediction`

  Dataclass for holding DNA sequence prediction outputs.

- `IterableData`

  Base class for iterable datasets in parallel multi-processing environments.

- `IterableJSONData`

  Class for iterating over lines of a JSON file.

#### Functions

- `load_python_object_from_disk(file_path: str) -> Any`

  Load a Pickle object from disk.

- `save_python_object_to_disk(input_object: Any, file_path: str) -> None`

  Save a Python object to disk using Pickle.

- `find_pattern_in_fasta(keyword: str, text: str) -> List[str]`

  Find a specific keyword pattern in text (useful for FASTA sequences).

- `get_organism2id_dict(organism_reference: str) -> Dict[str, int]`

  Get a dictionary mapping organisms to their indices.

- `get_taxonomy_id(taxonomy_reference: str, organism: str, return_dict: bool = False) -> Union[int, Dict[str, int]]`

  Get taxonomy ID for an organism or return the entire mapping.

- `sort_amino2codon_skeleton(amino2codon: Dict[str, List[str]]) -> Dict[str, List[str]]`

  Sort the amino2codon dictionary alphabetically.

- `load_pkl_from_url(url: str) -> Any`

  Download and load a Pickle file from a URL.
<br></br>


## CodonJupyter

The CodonJupyter subpackage offers Jupyter-specific functions for displaying interactive widgets, facilitating user interaction with the CodonTransformer package in a Jupyter notebook environment. It improves the user experience by providing interactive and visually appealing interfaces for input and output.

### Overview

This subpackage can be used for:

- Creating and displaying interactive widgets for organism selection and protein sequence input
- Handling user inputs and storing them in a container
- Formatting and displaying the model output in a visually appealing manner

### Classes and Functions

- `UserContainer`

  A container class to store user inputs for organism and protein sequence.

  **Attributes:**
  - `organism (int)`: The selected organism ID
  - `protein (str)`: The input protein sequence

- `display_organism_dropdown(organism2id: Dict[str, int], container: UserContainer) -> None`

  Display a dropdown widget for selecting an organism from a list and updates the organism ID in the provided container.

- `display_protein_input(container: UserContainer) -> None`

  Display a widget for entering a protein sequence and saves the entered sequence to the container.

- `format_model_output(output: DNASequencePrediction) -> str`

  Format the DNA sequence prediction output in a visually appealing and easy-to-read manner. Take a `DNASequencePrediction` object and return a formatted string.

### Usage
Checkout our [Google Colab Notebook](https://adibvafa.github.io/CodonTransformer/GoogleColab) for an example use case!
<br></br>

## Contribution
We welcome contributions to CodonTransformer! Please fork the repository and submit a pull request. For major changes, please open an issue first to discuss what you would like to change.
<br></br>

## Citation
If you use CodonTransformer or our data in your research, please cite our work:

```sh
@article {Fallahpour2024.09.13.612903,
	author = {Fallahpour, Adibvafa and Gureghian, Vincent and Filion, Guillaume J. and Lindner, Ariel B. and Pandi, Amir},
	title = {CodonTransformer: a multispecies codon optimizer using context-aware neural networks},
	elocation-id = {2024.09.13.612903},
	year = {2024},
	doi = {10.1101/2024.09.13.612903},
	publisher = {Cold Spring Harbor Laboratory},
	URL = {https://www.biorxiv.org/content/early/2024/09/13/2024.09.13.612903},
	eprint = {https://www.biorxiv.org/content/early/2024/09/13/2024.09.13.612903.full.pdf},
	journal = {bioRxiv}
}
```
