   
    
                                     
                    Biopython Tutorial and Cookbook
                    *******************************
 Jeff Chang, Brad Chapman, Iddo Friedberg, Thomas Hamelryck, Michiel de
 ======================================================================
                            Hoon, Peter Cock
                            ================
                       Last Update--15 June 2008
                       =========================
  

Contents
********
   
  
   - Chapter 1  Introduction 
     
      - 1.1  What is Biopython? 
        
         - 1.1.1  What can I find in the Biopython package 
     
      - 1.2  Installing Biopython 
      - 1.3  FAQ 
  
   - Chapter 2  Quick Start -- What can you do with Biopython? 
     
      - 2.1  General overview of what Biopython provides 
      - 2.2  Working with sequences 
      - 2.3  A usage example 
      - 2.4  Parsing sequence file formats 
        
         - 2.4.1  Simple FASTA parsing example 
         - 2.4.2  Simple GenBank parsing example 
         - 2.4.3  I love parsing -- please don't stop talking about it! 
     
      - 2.5  Connecting with biological databases 
      - 2.6  What to do next 
  
   - Chapter 3  Sequence objects 
     
      - 3.1  Sequences and Alphabets 
      - 3.2  Sequences act like strings 
      - 3.3  Slicing a sequence 
      - 3.4  Turning Seq objects into strings 
      - 3.5  Nucleotide sequences and (reverse) complements 
      - 3.6  Concatenating or adding sequences 
      - 3.7  MutableSeq objects 
      - 3.8  Transcribing and Translation 
      - 3.9  Working with directly strings 
  
   - Chapter 4  Sequence Input/Output 
     
      - 4.1  Parsing or Reading Sequences 
        
         - 4.1.1  Reading Sequence Files 
         - 4.1.2  Iterating over the records in a sequence file 
         - 4.1.3  Getting a list of the records in a sequence file 
         - 4.1.4  Extracting data 
     
      - 4.2  Parsing sequences from the net 
        
         - 4.2.1  Parsing GenBank records from the net 
         - 4.2.2  Parsing SwissProt sequences from the net 
     
      - 4.3  Sequence files as Dictionaries 
        
         - 4.3.1  Specifying the dictionary keys 
         - 4.3.2  Indexing a dictionary using the SEGUID checksum 
     
      - 4.4  Writing Sequence Files 
        
         - 4.4.1  Converting between sequence file formats 
         - 4.4.2  Converting a file of sequences to their reverse
         complements 
     
  
   - Chapter 5  Sequence Alignment Input/Output 
     
      - 5.1  Parsing or Reading Sequence Alignments 
        
         - 5.1.1  Single Alignments 
         - 5.1.2  Multiple Alignments 
         - 5.1.3  Ambiguous Alignments 
     
      - 5.2  Writing Alignments 
        
         - 5.2.1  Converting between sequence alignment file formats 
     
  
   - Chapter 6  BLAST 
     
      - 6.1  Running BLAST locally 
      - 6.2  Running BLAST over the Internet 
      - 6.3  Saving BLAST output 
      - 6.4  Parsing BLAST output 
      - 6.5  The BLAST record class 
      - 6.6  Deprecated BLAST parsers 
        
         - 6.6.1  Parsing plain-text BLAST output 
         - 6.6.2  Parsing a file full of BLAST runs 
         - 6.6.3  Finding a bad record somewhere in a huge file 
     
      - 6.7  Dealing with PSIBlast 
  
   - Chapter 7  Accessing NCBI's Entrez databases 
     
      - 7.1  Entrez Guidelines 
      - 7.2  EInfo: Obtaining information about the Entrez databases 
      - 7.3  ESearch: Searching the Entrez databases 
      - 7.4  EPost 
      - 7.5  ESummary: Retrieving summaries from primary IDs 
      - 7.6  EFetch: Downloading full records from Entrez 
      - 7.7  ELink 
      - 7.8  EGQuery: Obtaining counts for search terms 
      - 7.9  ESpell: Obtaining spelling suggestions 
      - 7.10  Examples 
        
         - 7.10.1  Searching and downloading Entrez Nucleotide records 
         - 7.10.2  Finding the lineage of an organism 
         - 7.10.3  Using the history and WebEnv 
     
  
   - Chapter 8  Swiss-Prot, Prosite, Prodoc, and ExPASy 
     
      - 8.1  Bio.SwissProt: Parsing Swiss-Prot files 
        
         - 8.1.1  Parsing Swiss-Prot records 
         - 8.1.2  Parsing the Swiss-Prot keyword and category list 
     
      - 8.2  Bio.Prosite: Parsing Prosite records 
      - 8.3  Bio.Prosite.Prodoc: Parsing Prodoc records 
      - 8.4  Bio.ExPASy: Accessing the ExPASy server 
        
         - 8.4.1  Retrieving a Swiss-Prot record 
         - 8.4.2  Searching Swiss-Prot 
         - 8.4.3  Retrieving Prosite and Prodoc records 
     
  
   - Chapter 9  Cookbook -- Cool things to do with it 
     
      - 9.1  PubMed 
        
         - 9.1.1  Sending a query to PubMed 
         - 9.1.2  Retrieving a PubMed record 
     
      - 9.2  GenBank 
        
         - 9.2.1  Retrieving GenBank entries from NCBI 
         - 9.2.2  Parsing GenBank records 
         - 9.2.3  Iterating over GenBank records 
     
      - 9.3  Dealing with alignments 
        
         - 9.3.1  Clustalw 
         - 9.3.2  Calculating summary information 
         - 9.3.3  Calculating a quick consensus sequence 
         - 9.3.4  Position Specific Score Matrices 
         - 9.3.5  Information Content 
         - 9.3.6  Translating between Alignment formats 
     
      - 9.4  Substitution Matrices 
        
         - 9.4.1  Using common substitution matrices 
         - 9.4.2  Creating your own substitution matrix from an
         alignment 
     
      - 9.5  BioSQL -- storing sequences in a relational database 
      - 9.6  BioCorba 
      - 9.7  Going 3D: The PDB module 
        
         - 9.7.1  Structure representation 
         - 9.7.2  Disorder 
         - 9.7.3  Hetero residues 
         - 9.7.4  Some random usage examples 
         - 9.7.5  Common problems in PDB files 
         - 9.7.6  Other features 
     
      - 9.8  Bio.PopGen: Population genetics 
        
         - 9.8.1  GenePop 
         - 9.8.2  Coalescent simulation 
         - 9.8.3  Other applications 
         - 9.8.4  Future Developments 
     
      - 9.9  InterPro 
  
   - Chapter 10  Advanced 
     
      - 10.1  The SeqRecord and SeqFeature classes 
        
         - 10.1.1  Sequence ids and Descriptions -- dealing with
         SeqRecords 
         - 10.1.2  Features and Annotations -- SeqFeatures 
     
      - 10.2  Regression Testing Framework 
        
         - 10.2.1  Writing a Regression Test 
     
      - 10.3  Parser Design 
      - 10.4  Substitution Matrices 
        
         - 10.4.1  SubsMat 
         - 10.4.2  FreqTable 
     
  
   - Chapter 11  Where to go from here -- contributing to Biopython 
     
      - 11.1  Maintaining a distribution for a platform 
      - 11.2  Bug Reports + Feature Requests 
      - 11.3  Contributing Code 
  
   - Chapter 12  Appendix: Useful stuff about Python 
     
      - 12.1  What the heck is a handle? 
        
         - 12.1.1  Creating a handle from a string 
     
  
   
  

Chapter 1    Introduction
*************************
   
  

1.1  What is Biopython?
*=*=*=*=*=*=*=*=*=*=*=*

  
  The Biopython Project is an international association of developers of
freely available Python (http://www.python.org) tools for computational
molecular biology. The web site http://www.biopython.org provides an
online resource for modules, scripts, and web links for developers of
Python-based software for life science research.
  Basically, we just like to program in python and want to make it as
easy as possible to use python for bioinformatics by creating
high-quality, reusable modules and scripts.
  

1.1.1  What can I find in the Biopython package
===============================================
  
  The main Biopython releases have lots of functionality, including:
  
  
   - The ability to parse bioinformatics files into python utilizable
   data structures, including support for the following formats:
 
     
      - Blast output -- both from standalone and WWW Blast 
      - Clustalw 
      - FASTA 
      - GenBank 
      - PubMed and Medline 
      - Expasy files, like Enzyme, Prodoc and Prosite 
      - SCOP, including `dom' and `lin' files 
      - UniGene 
      - SwissProt 
 
 
   - Files in the supported formats can be iterated over record by
   record or indexed and accessed via a Dictionary interface.
 
   - Code to deal with popular on-line bioinformatics destinations such
   as:
 
     
      - NCBI -- Blast, Entrez and PubMed services 
      - Expasy -- Prodoc and Prosite entries 
 
 
   - Interfaces to common bioinformatics programs such as:
 
     
      - Standalone Blast from NCBI 
      - Clustalw alignment program. 
 
 
   - A standard sequence class that deals with sequences, ids on
   sequences, and sequence features.
 
   - Tools for performing common operations on sequences, such as
   translation, transcription and weight calculations.
 
   - Code to perform classification of data using k Nearest Neighbors,
   Naive Bayes or Support Vector Machines.
 
   - Code for dealing with alignments, including a standard way to
   create and deal with substitution matrices.
 
   - Code making it easy to split up parallelizable tasks into separate
   processes.
 
   - GUI-based programs to do basic sequence manipulations,
   translations, BLASTing, etc.
 
   - Extensive documentation and help with using the modules, including
   this file, on-line wiki documentation, the web site, and the mailing
   list.
 
   - Integration with other languages, including the Bioperl and Biojava
   projects, using the BioCorba interface standard (available with the
   biopython-corba module).
  
  We hope this gives you plenty of reasons to download and start using
Biopython!
  

1.2  Installing Biopython
*=*=*=*=*=*=*=*=*=*=*=*=*

  
  All of the installation information for Biopython was separated from
this document to make it easier to keep updated. The instructions cover
installation of python, Biopython dependencies and Biopython itself. It
is available in pdf
(http://biopython.org/DIST/docs/install/Installation.pdf) and html
formats (http://biopython.org/DIST/docs/install/Installation.html).
  

1.3  FAQ
*=*=*=*=

  
  
 
 
   1. Why doesn't 'Bio.SeqIO' work? It imports fine but there is no
   parse function etc.
  You need Biopython 1.43 or later. Older versions did contain some
   related code under the 'Bio.SeqIO' name which has since been
   deprecated - and this is why the import "works".
 
   2. Why doesn't 'Bio.SeqIO.read()' work? The module imports fine but
   there is no read function!
  You need Biopython 1.45 or later.
 
   3. Why doesn't 'Bio.Blast' work with the latest plain text NCBI blast
   output?
  The NCBI keep tweaking the plain text output from the BLAST tools, and
   keeping our parser up to date is an ongoing struggle. We recommend
   you use the XML output instead, which is designed to be read by a
   computer program.
 
   4. Why isn't 'Bio.AlignIO)' present? The module import fails!
  You need Biopython 1.46 or later.
 
   5. Why doesn't 'Bio.Entrez.read()' work? The module imports fine but
   there is no read function!
  You need Biopython 1.46 or later.
 
   6. I looked in a directory for code, but I couldn't seem to find the
   code that does something. Where's it hidden?
  One thing to know is that we put code in '__init__.py' files. If you
   are not used to looking for code in this file this can be confusing.
   The reason we do this is to make the imports easier for users. For
   instance, instead of having to do a "repetitive" import like 'from
   Bio.GenBank import GenBank', you can just import like 'from Bio
   import GenBank'.
  
  

Chapter 2    Quick Start -- What can you do with Biopython?
***********************************************************
   
  This section is designed to get you started quickly with Biopython,
and to give a general overview of what is available and how to use it.
All of the examples in this section assume that you have some general
working knowledge of python, and that you have successfully installed
Biopython on your system. If you think you need to brush up on your
python, the main python web site provides quite a bit of free
documentation to get started with (http://www.python.org/doc/).
  Since much biological work on the computer involves connecting with
databases on the internet, some of the examples will also require a
working internet connection in order to run.
  Now that that is all out of the way, let's get into what we can do
with Biopython.
  

2.1  General overview of what Biopython provides
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=

  
  As mentioned in the introduction, Biopython is a set of libraries to
provide the ability to deal with "things" of interest to biologists
working on the computer. In general this means that you will need to
have at least some programming experience (in python, of course!) or at
least an interest in learning to program. Biopython's job is to make
your job easier as a programmer by supplying reusable libraries so that
you can focus on answering your specific question of interest, instead
of focusing on the internals of parsing a particular file format (of
course, if you want to help by writing a parser that doesn't exist and
contributing it to Biopython, please go ahead!). So Biopython's job is
to make you happy!
  One thing to note about Biopython is that it often provides multiple
ways of "doing the same thing." To me, this can be frustrating since I
often way to just know the one right way to do something. However, this
is also a real benefit because it gives you lots of flexibility and
control over the libraries. The tutorial helps to show you the common or
easy ways to do things so that you can just make things work. To learn
more about the alternative possibilities, look into the Cookbook section
(which tells you some cools tricks and tips) and the Advanced section
(which provides you with as much detail as you'd ever want to know!).
  

2.2  Working with sequences
*=*=*=*=*=*=*=*=*=*=*=*=*=*

   
  Disputedly (of course!), the central object in bioinformatics is the
sequence. Thus, we'll start with a quick introduction to the Biopython
mechanisms for dealing with sequences, the 'Seq' object, which we'll
discuss in more detail in Chapter 3.
  Most of the time when we think about sequences we have in my mind a
string of letters like ''AGTACACTGGT''. You can create such 'Seq' object
with this sequence as follows - the ">>>" represents the python prompt
followed by what you would type in:
<<>>> from Bio.Seq import Seq
  >>> my_seq = Seq("AGTACACTGGT")
  >>> my_seq.alphabet
  Alphabet()
  >>> print my_seq.tostring()
  AGTACACTGGT
>>
  
  What we have here is a sequence object with a generic alphabet -
reflecting the fact we have not specified if this is a DNA or protein
sequence (okay, a protein with a lot of Alanines, Glycines, Cysteines
and Threonines!). We'll talk more about alphabets in Chapter 3.
  In addition to having an alphabet, the 'Seq' object differs from the
python string in the methods it supports. You can't do this with a plain
string:
<<>>> my_seq
  Seq('AGTACACTGGT', Alphabet())
  >>> my_seq.complement()
  Seq('TCATGTGACCA', Alphabet())
  >>> my_seq.reverse_complement()
  Seq('ACCAGTGTACT', Alphabet())
>>
  
  The next most important class is the 'SeqRecord' or Sequence Record.
This holds a sequence (as a 'Seq' object) with additional annotation
including an identifier, name and description. The 'Bio.SeqIO' module
for reading and writing sequence file formats works with 'SeqRecord'
objects, which will be introduced below and cover in more detail by
Chapter 4.
  This covers the basic features and uses of the Biopython sequence
class. Now that you've got some idea of what it is like to interact with
the Biopython libraries, it's time to delve into the fun, fun world of
dealing with biological file formats!
  

2.3  A usage example
*=*=*=*=*=*=*=*=*=*=

   
  Before we jump right into parsers and everything else to do with
Biopython, let's set up an example to motivate everything we do and make
life more interesting. After all, if there wasn't any biology in this
tutorial, why would you want you read it?
  Since I love plants, I think we're just going to have to have a plant
based example (sorry to all the fans of other organisms out there!).
Having just completed a recent trip to our local greenhouse, we've
suddenly developed an incredible obsession with Lady Slipper Orchids (if
you wonder why, have a look at some Lady Slipper Orchids photos on
Flickr (1), or try a Google Image Search (2)).
  Of course, orchids are not only beautiful to look at, they are also
extremely interesting for people studying evolution and systematics. So
let's suppose we're thinking about writing a funding proposal to do a
molecular study of Lady Slipper evolution, and would like to see what
kind of research has already been done and how we can add to that.
  After a little bit of reading up we discover that the Lady Slipper
Orchids are in the Orchidaceae family and the Cypripedioideae sub-family
and are made up of 5 genera: Cypripedium, Paphiopedilum, Phragmipedium,
Selenipedium and Mexipedium.
  That gives us enough to get started delving for more information. So,
let's look at how the Biopython tools can help us. We'll start with
sequence parsing in Section 2.4, but the orchids will be back later on
as well - for example we'll extra data from Swiss-Prot from certain
orchid proteins in Chapter 8, search PubMed for papers about orchids in
Section 9.1, extract sequence data from GenBank in Section 9.2.1, and
work with ClustalW multiple sequence alignments of orchid proteins in
Section 9.3.1.
  

2.4  Parsing sequence file formats
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=

   
  A large part of much bioinformatics work involves dealing with the
many types of file formats designed to hold biological data. These files
are loaded with interesting biological data, and a special challenge is
parsing these files into a format so that you can manipulate them with
some kind of programming language. However the task of parsing these
files can be frustrated by the fact that the formats can change quite
regularly, and that formats may contain small subtleties which can break
even the most well designed parsers.
  We are now going to briefly introduce the 'Bio.SeqIO' module -- you
can find out more in Chapter 4. We'll start with an online search for
our friends, the lady slipper orchids. To keep this introduction simple,
we're just using the NCBI website by hand. Let's just take a look
through the nucleotide databases at NCBI, using an Entrez online search
(http://www.ncbi.nlm.nih.gov:80/entrez/query.fcgi?db=Nucleotide) for
everything mentioning the text Cypripedioideae (this is the subfamily of
lady slipper orchids). 
  When this tutorial was originally written, this search gave us only 94
hits, which we saved as a FASTA formatted text file
(ls_orchid.fasta (3); also available online here (4)) and as a GenBank
formatted text file (ls_orchid.gbk (5); also available online here (6)).
  If you run the search today, you'll get hundreds of results! When
following the tutorial, if you want to see the same list of genes, just
download the two files above or copy them from 'docs/examples/' in the
Biopython source code. In Section 2.5 we will look at how to do a search
like this from within python.
  

2.4.1  Simple FASTA parsing example
===================================
   
  If you open the lady slipper orchids FASTA file in your favourite text
editor, you'll see that the file starts like this:
<<>gi|2765658|emb|Z78533.1|CIZ78533 C.irapeanum 5.8S rRNA gene and ITS1
and ITS2 DNA
  CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGATGAGACCGTGGAATAAACGATCGAGTG
  AATCCGGAGGACCGGTGTACTCAGCTCACCGGGGGCATTGCTCCCGTGGTGACCCTGATTTGTTGTTGGG
  ...
>>
  
  It contains 94 records, each has a line starting with ">"
(greater-than symbol) followed by the sequence on one or more lines. Now
try this in python:
<<from Bio import SeqIO
  handle = open("ls_orchid.fasta")
  for seq_record in SeqIO.parse(handle, "fasta") :
      print seq_record.id
      print repr(seq_record.seq)
      print len(seq_record)
  handle.close()
>>
  
  You should get something like this on your screen:
<<gi|2765658|emb|Z78533.1|CIZ78533
  Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGATGAGACCGTGG...CGC',
SingleLetterAlphabet())
  740
  ...
  gi|2765564|emb|Z78439.1|PBZ78439
  Seq('CATTGTTGAGATCACATAATAATTGATCGAGTTAATCTGGAGGATCTGTTTACT...GCC',
SingleLetterAlphabet())
  592
>>
  
  Notice that the FASTA format does not specify the alphabet, so
'Bio.SeqIO' has defaulted to the rather generic 'SingleLetterAlphabet()'
rather than something DNA specific.
  

2.4.2  Simple GenBank parsing example
=====================================
  
  Now let's load the GenBank file instead - notice that the code to do
this is almost identical to the snippet used above for a FASTA file -
the only difference is we changed the filename and the format string:
<<from Bio import SeqIO
  handle = open("ls_orchid.gbk")
  for seq_record in SeqIO.parse(handle, "genbank") :
      print seq_record.id
      print repr(seq_record.seq)
      print len(seq_record)
  handle.close()
>>
  
  This should give:
<<Z78533.1
  Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGATGAGACCGTGG...CGC',
IUPACAmbiguousDNA())
  740
  ...
  Z78439.1
  Seq('CATTGTTGAGATCACATAATAATTGATCGAGTTAATCTGGAGGATCTGTTTACT...GCC',
IUPACAmbiguousDNA())
  592
>>
  
  This time 'Bio.SeqIO' has been able to choose a sensible alphabet,
IUPAC Ambiguous DNA. You'll also notice that a shorter string has been
used as the 'seq_record.id' in this case.
  

2.4.3  I love parsing -- please don't stop talking about it!
============================================================
  
  Biopython has a lot of parsers, and each has its own little special
niches based on the sequence format it is parsing and all of that. While
the most popular file formats have parsers integrated into 'Bio.SeqIO',
for some of the rarer and unloved file formats there is either no parser
at all, or an old parser which has not been linked in yet.
  Chapter 4 covers 'Bio.SeqIO' in more detail. Please also check the
wiki page (http://biopython.org/wiki/SeqIO) for the latest information,
or ask on the mailing list. The wiki page should includes an up to date
list of supported file types, and more examples including writing
sequences to a file, and converting between file formats.
  If you are interested in sequence alignments, then look at the
'Bio.AlignIO' module introduced in Chapter 5. Again, there is a wiki
page for this too (http://biopython.org/wiki/AlignIO).
  The next place to look for information about specific parsers and how
to do cool things with them is in the Cookbook, Section 9 of this
Tutorial. If you don't find the information you are looking for, please
consider helping out your poor overworked documentors and submitting a
cookbook entry about it! (once you figure out how to do it, that is!)
  

2.5  Connecting with biological databases
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*

   
  One of the very common things that you need to do in bioinformatics is
extract information from biological databases. It can be quite tedious
to access these databases manually, especially if you have a lot of
repetitive work to do. Biopython attempts to save you time and energy by
making some on-line databases available from python scripts. Currently,
Biopython has code to extract information from the following databases:
  
  
   - ExPASy (7) -- See Chapter 8 in the Cookbook for more information. 
   - Entrez from NCBI (8) -- See Section 7.10. 
   - PubMed from NCBI (9) -- See Section 9.1 in the Cookbook for example
   code detailing how to use this. 
   - SCOP (10) 
  
  The code is these modules basically makes it easy to write python code
that interact with the CGI scripts on these pages, so that you can get
results in an easy to deal with format. In some cases, the results can
be tightly integrated with the Biopython parsers to make it even easier
to extract information.
  

2.6  What to do next
*=*=*=*=*=*=*=*=*=*=

  
  Now that you've made it this far, you hopefully have a good
understanding of the basics of Biopython and are ready to start using it
for doing useful work. The best thing to do now is to start snooping
around in the source code and looking at the automatically generated
documentation.
  Once you get a picture of what you want to do, and what libraries in
Biopython will do it, you should take a peak at the Cookbook, which may
have example code to do something similar to what you want to do.
  If you know what you want to do, but can't figure out how to do it,
please feel free to post questions to the main biopython list
(biopython@biopython.org). This will not only help us answer your
question, it will also allow us to improve the documentation so it can
help the next person do what you want to do.
  Enjoy the code!
-----------------------------------
  
  
 (1) http://www.flickr.com/search/?q=lady+slipper+orchid&s=int&z=t
 
 (2) http://images.google.com/images?q=lady%20slipper%20orchid
 
 (3) examples/ls_orchid.fasta
 
 (4) http://biopython.org/DIST/docs/tutorial/examples/ls_orchid.fasta
 
 (5) examples/ls_orchid.gbk
 
 (6) http://biopython.org/DIST/docs/tutorial/examples/ls_orchid.gbk
 
 (7) http://www.expasy.org/
 
 (8) http://www.ncbi.nlm.nih.gov/Entrez/
 
 (9) http://www.ncbi.nlm.nih.gov/PubMed/
 
 (10) http://scop.mrc-lmb.cam.ac.uk/scop/
  

Chapter 3    Sequence objects
*****************************
   
  Biological sequences are arguably the central object in
Bioinformatics, and in this chapter we'll introduce the Biopython
mechanism for dealing with sequences, the 'Seq' object. In Chapter 4 on
Sequence Input/Output (and Section 10.1), we'll see that the 'Seq'
object is also used in the 'SeqRecord' object, which combines the
sequence information with any annotation.
  Sequences are essentially strings of letters like 'AGTACACTGGT', which
seems very natural since this is the most common way that sequences are
seen in biological file formats.
  There are two important differences between the 'Seq' object and
standard python strings. First of all the Seq object has a slightly
different set of methods to a plain python string (for example, a
'reverse_complement()' method used for nucleotide sequences). Secondly,
the 'Seq' object has an important attribute, 'alphabet', which is an
object describing what the individual characters making up the sequence
string "mean", and how they should be interpreted. For example, is
'AGTACACTGGT' a DNA sequence, or just a protein sequence that happens to
be rich in Alanines, Glycines, Cysteines and Threonines?
  

3.1  Sequences and Alphabets
*=*=*=*=*=*=*=*=*=*=*=*=*=*=

  
  The alphabet object is perhaps the important thing that makes the
'Seq' object more than just a string. The currently available alphabets
for Biopython are defined in the 'Bio.Alphabet' module. We'll use the
IUPAC alphabets (http://www.chem.qmw.ac.uk/iupac/) here to deal with
some of our favorite objects: DNA, RNA and Proteins.
  'Bio.Alphabet.IUPAC' provides basic definitions for proteins, DNA and
RNA, but additionally provides the ability to extend and customize the
basic definitions. For instance, for proteins, there is a basic
IUPACProtein class, but there is an additional ExtendedIUPACProtein
class providing for the additional elements "Asx" (asparagine or
aspartic acid), "Sec" (selenocysteine), and "Glx" (glutamine or glutamic
acid). For DNA you've got choices of IUPACUnambiguousDNA, which provides
for just the basic letters, IUPACAmbiguousDNA (which provides for
ambiguity letters for every possible situation) and ExtendedIUPACDNA,
which allows letters for modified bases. Similarly, RNA can be
represented by IUPACAmbiguousRNA or IUPACUnambiguousRNA.
  The advantages of having an alphabet class are two fold. First, this
gives an idea of the type of information the Seq object contains.
Secondly, this provides a means of constraining the information, as a
means of type checking.
  Now that we know what we are dealing with, let's look at how to
utilize this class to do interesting work. You can create an ambiguous
sequence with the default generic alphabet like this:
<<>>> from Bio.Seq import Seq
  >>> my_seq = Seq("AGTACACTGGT")
  >>> my_seq
  Seq('AGTACACTGGT', Alphabet())
  >>> my_seq.alphabet
  Alphabet()
>>
  
  However, where possible you should specify the alphabet explicitly
when creating your sequence objects - in this case an unambiguous DNA
alphabet object:
<<>>> from Bio.Seq import Seq
  >>> from Bio.Alphabet import IUPAC
  >>> my_seq = Seq('AGTACACTGGT', IUPAC.unambiguous_dna)
  >>> my_seq
  Seq('AGTACACTGGT', IUPACUnambiguousDNA())
  >>> my_seq.alphabet
  IUPACUnambiguousDNA()
>>
  
  

3.2  Sequences act like strings
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*

  
  In many ways, we can deal with Seq objects as if they were normal
python strings, for example getting the length, or iterating over the
elements:
<<from Bio.Seq import Seq
  from Bio.Alphabet import IUPAC
  my_seq = Seq('GATCGATGGGCCTATATAGGATCGAAAATCGC',
IUPAC.unambiguous_dna)
  for index, letter in enumerate(my_seq) :
      print index, letter
  print len(letter)
>>
  
  You can access elements of the sequence in the same way as for strings
(but remember, python counts from zero!):
<<>>> print my_seq[0] #first element
  >>> print my_seq[2] #third element
  >>> print my_seq[-1] #list element
>>
  
  The 'Seq' object has a '.count()' method, just like a string:
<<>>> len(my_seq)
  32
  >>> my_seq.count("G")
  10
  >>> float(my_seq.count("G") + my_seq.count("C")) / len(my_seq)
  0.46875
>>
  
  While you could use the above snippet of code to calculate a GC%, note
that Biopython does have some GC functions already built in, see the
'Bio.SeqUtils' module.
  

3.3  Slicing a sequence
*=*=*=*=*=*=*=*=*=*=*=*

  
  A more complicated example, let's get a slice of the sequence:
<<>>> from Bio.Seq import Seq
  >>> from Bio.Alphabet import IUPAC
  >>> my_seq = Seq('GATCGATGGGCCTATATAGGATCGAAAATCGC',
IUPAC.unambiguous_dna)
  >>> my_seq[4:12]
  Seq('GATGGGCC', IUPACUnambiguousDNA())
>>
  
  Two things are interesting to note. First, this follows the normal
conventions for python strings. So the first element of the sequence is
0 (which is normal for computer science, but not so normal for biology).
When you do a slice the first item is included (i. e. 4 in this case)
and the last is excluded (12 in this case), which is the way things work
in python, but of course not necessarily the way everyone in the world
would expect. The main goal is to stay consistent with what python does.
  The second thing to notice is that the slice is performed on the
sequence data string, but the new object produced is another 'Seq'
object which retains the alphabet information from the original 'Seq'
object.
  Also like a python string, you can do slices with a start, stop and
stride (the step size, which defaults to one). For example, we can get
the first, second and third codon positions of this DNA sequence:
<<>>> my_seq[0::3]
  Seq('GCTGTAGTAAG', IUPACUnambiguousDNA())
  >>> my_seq[1::3]
  Seq('AGGCATGCATC', IUPACUnambiguousDNA())
  >>> my_seq[2::3]
  Seq('TAGCTAAGAC', IUPACUnambiguousDNA())
>>
  
  Another stride trick you might have seen with a python string is the
use of a -1 stride to reverse the string. You can do this with a 'Seq'
object too:
<<>>> my_seq[::-1]
  Seq('CGCTAAAAGCTAGGATATATCCGGGTAGCTAG', IUPACUnambiguousDNA())
>>
  
  

3.4  Turning Seq objects into strings
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*

  
  If you are really do just need a plain string, for example to print
out, write to a file, or insert into a database, then this is very easy
to get:
<<>>> my_seq.tostring()
  'GATCGATGGGCCTATATAGGATCGAAAATCGC'
>>
  
  

3.5  Nucleotide sequences and (reverse) complements
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*

   
  For nucleotide sequences, you can easily obtain the complement or
reverse complement of a Seq object:
<<>>> my_seq
  Seq('GATCGATGGGCCTATATAGGATCGAAAATCGC', IUPACUnambiguousDNA())
  >>> my_seq.complement()
  Seq('CTAGCTACCCGGATATATCCTAGCTTTTAGCG', IUPACUnambiguousDNA())
  >>> my_seq.reverse_complement()
  Seq('GCGATTTTCGATCCTATATAGGCCCATCGATC', IUPACUnambiguousDNA())
>>
  
  In all of these operations, the alphabet property is maintained. This
is very useful in case you accidentally end up trying to do something
weird like take the (reverse)complement of a protein seuqence:
<<>>> protein_seq = Seq("EVRNAK", IUPAC.protein)
  >>> dna_seq = Seq("ACGT", IUPAC.unambiguous_dna)
  >>> protein_seq.complement()
  Traceback (most recent call last):
    File "<stdin>", line 1, in ?
    File "/usr/local/lib/python2.4/site-packages/Bio/Seq.py", line 108,
in complement
      raise ValueError, "Proteins do not have complements!"
  ValueError: Proteins do not have complements!
>>
  
  

3.6  Concatenating or adding sequences
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=

  
  Naturally, you can in principle add any two Seq objects together -
just like you can with python strings to concatenate them. However, you
can't add sequences with incompatible alphabets, such as a protein
sequence and a DNA sequence:
<<>>> protein_seq + dna_seq
  Traceback (most recent call last):
    File "<stdin>", line 1, in ?
    File "/usr/local/lib/python2.4/site-packages/Bio/Seq.py", line 42,
in __add__
      raise TypeError, ("incompatable alphabets", str(self.alphabet),
  TypeError: ('incompatable alphabets', 'IUPACProtein()',
'IUPACUnambiguousDNA()')
>>
  
  If you really wanted to do this, you'd have to first give both
sequences generic alphabets:
<<>>> from Bio.Alphabet import generic_alphabet
  >>> protein_seq.alphabet = generic_alphabet
  >>> dna_seq.alphabet = generic_alphabet
  >>> protein_seq + dna_seq
  Seq('EVRNAKACGT', Alphabet())
>>
  
  Here is an example of adding a generic nucleotide sequence to an
unambiguous IUPAC DNA sequence, resulting in an ambiguous nucleotide
sequence:
<<>>> from Bio.Seq import Seq
  >>> from Bio.Alphabet import generic_nucleotide
  >>> from Bio.Alphabet import IUPAC
  >>> nuc_seq = Seq('GATCGATGC', generic_nucleotide)
  >>> dna_seq = Seq('ACGT', IUPAC.unambiguous_dna)
  >>> nuc_seq
  Seq('GATCGATGC', NucleotideAlphabet())
  >>> dna_seq
  Seq('ACGT', IUPACUnambiguousDNA())
  >>> nuc_seq + dna_seq
  Seq('GATCGATGCACGT', NucleotideAlphabet())
>>
  
  

3.7  MutableSeq objects
*=*=*=*=*=*=*=*=*=*=*=*

  
  Just like the normal python string, the 'Seq' object is "read only",
or in python terminology, not mutable. Apart from the wanting the 'Seq'
object to act like a string, this is also a useful default since in many
biological applications you want to ensure you are not changing your
sequence data:
<<>>> my_seq[5] = "G"
  Traceback (most recent call last):
    File "<stdin>", line 1, in ?
  AttributeError: 'Seq' instance has no attribute '__setitem__'
>>
  
  However, you can convert it into a mutable sequence (a 'MutableSeq'
object) and do pretty much anything you want with it:
<<>>> mutable_seq = my_seq.tomutable()
  >>> print mutable_seq
  MutableSeq('GATCGATGGGCCTATATAGGATCGAAAATCGC', IUPACUnambiguousDNA())
  >>> mutable_seq[5] = "T"
  >>> print mutable_seq
  MutableSeq('GATCGTTGGGCCTATATAGGATCGAAAATCGC', IUPACUnambiguousDNA())
  >>> mutable_seq.remove("T")
  >>> print mutable_seq
  MutableSeq('GACGTTGGGCCTATATAGGATCGAAAATCGC', IUPACUnambiguousDNA())
  >>> mutable_seq.reverse()
  >>> print mutable_seq
  MutableSeq('CGCTAAAAGCTAGGATATATCCGGGTTGCAG', IUPACUnambiguousDNA())
>>
  
  

3.8  Transcribing and Translation
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*

  
  Now that the nature of the sequence object makes some sense, the next
thing to look at is what kind of things we can do with a sequence. The
'Bio' directory contains two useful modules to transcribe and translate
a sequence object. These tools work based on the alphabet of the
sequence.
  For instance, let's supposed we want to transcribe a DNA sequence:
<<>>> from Bio.Seq import Seq
  >>> from Bio.Alphabet import IUPAC
  >>> my_seq = Seq("GATCGATGGGCCTATATAGGATCGAAAATCGC",
IUPAC.unambiguous_dna)
>>
  
  This contains an unambiguous alphabet, so to transcribe we would do
the following:
<<>>> from Bio import Transcribe
  >>> transcriber = Transcribe.unambiguous_transcriber
  >>> my_rna_seq = transcriber.transcribe(my_seq)
  >>> print my_rna_seq
  Seq('GAUCGAUGGGCCUAUAUAGGAUCGAAAAUCGC', IUPACUnambiguousRNA())
>>
  
  The alphabet of the new RNA Seq object is created for free, so again,
dealing with a 'Seq' object is no more difficult then dealing with a
simple string.
  You can also reverse transcribe RNA sequences:
<<>>> transcriber.back_transcribe(my_rna_seq)
  Seq('GATCGATGGGCCTATATAGGATCGAAAATCGC', IUPACUnambiguousDNA())
>>
  
  To translate our DNA object we have quite a few choices. First, we can
use any number of translation tables depending on what we know about our
DNA sequence. The translation tables available in biopython were taken
from information at ftp://ftp.ncbi.nlm.nih.gov/entrez/misc/data/gc.prt.
So, you have tons of choices to pick from. For this, let's just focus on
two choices: the Standard translation table, and the Translation table
for Vertebrate Mitochondrial DNA. These tables are labeled with id
numbers 1 and 2, respectively. Now that we know what tables we are
looking to get, we're all set to perform a basic translation. First, we
need to get our translators that use these tables. Since we are still
dealing with our unambiguous DNA object, we want to fetch translators
that take this into account:
<<>>> from Bio import Translate
  >>> standard_translator = Translate.unambiguous_dna_by_id[1]
  >>> mito_translator = Translate.unambiguous_dna_by_id[2]
>>
  
  Once we've got the proper translators, it's time to go ahead and
translate a sequence:
<<>>> my_seq = Seq("GCCATTGTAATGGGCCGCTGAAAGGGTGCCCGA",
IUPAC.unambiguous_dna)
  >>> standard_translator.translate(my_seq)
  Seq('AIVMGR*KGAR', IUPACProtein())
  >>> mito_translator.translate(my_seq)
  Seq('AIVMGRWKGAR', IUPACProtein())
>>
  
  Notice that the default translation will just go ahead and proceed
blindly through a stop codon. If you are aware that you are translating
some kind of open reading frame and want to just see everything up until
the stop codon, this can be easily done with the 'translate_to_stop'
function:
<<>>> standard_translator.translate_to_stop(my_seq)
  Seq('AIVMGR', IUPACProtein())
>>
  
  Similar to the transcriber, it is also possible to reverse translate a
protein into a DNA sequence:
<<>>> my_protein = Seq("AVMGRWKGGRAAG", IUPAC.protein)
  >>> standard_translator.back_translate(my_protein)
  Seq('GCTGTTATGGGTCGTTGGAAGGGTGGTCGTGCTGCTGGT', IUPACUnambiguousDNA())
>>
  
  

3.9  Working with directly strings
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=

  
  To close this chapter, for those you who really don't want to use the
sequence objects, there are a few module level functions in 'Bio.Seq'
which will accept plain python strings (or 'Seq' objects or 'MutableSeq'
objects):
<<>>> from Bio.Seq import reverse_complement, transcribe,
back_transcribe, translate
  >>> my_string = "GCTGTTATGGGTCGTTGGAAGGGTGGTCGTGCTGCTGGTTAG"
  >>> reverse_complement(my_string)
  'CTAACCAGCAGCACGACCACCCTTCCAACGACCCATAACAGC'
  >>> transcribe(my_string)
  'GCUGUUAUGGGUCGUUGGAAGGGUGGUCGUGCUGCUGGUUAG'
  >>> back_transcribe(my_string)
  'GCTGTTATGGGTCGTTGGAAGGGTGGTCGTGCTGCTGGTTAG'
  >>> translate(my_string)
  'AVMGRWKGGRAAG*'
>>
  
  You are however, encouraged to work with the 'Seq' object by default.
  

Chapter 4    Sequence Input/Output
**********************************
   
  In this chapter we'll discuss in more detail the 'Bio.SeqIO' module,
which was briefly introduced in Chapter 2. This is a relatively new
interface, added in Biopython 1.43, which aims to provide a simple
interface for working with assorted sequence file formats in a uniform
way.
  The "catch" is that you have to work with 'SeqRecord' ojects - which
contain a 'Seq' object (as described in Chapter 3) plus annotation like
an identifier and description. We'll introduce the basics of 'SeqRecord'
object in this chapter, but see Section 10.1 for more details.
  

4.1  Parsing or Reading Sequences
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*

  
  The workhorse function 'Bio.SeqIO.parse()' is used to read in sequence
data as SeqRecord objects. This function expects two arguments:
  
  
   1. The first argument is a handle to read the data from. A handle is
   typically a file opened for reading, but could be the output from a
   command line program, or data downloaded from the internet (see
   Section 4.2). See Section 12.1 for more about handles. 
   2. The second argument is a lower case string specifying sequence
   format -- we don't try and guess the file format for you! See
   http://biopython.org/wiki/SeqIO for a full listing of supported
   formats. 
  
  This returns an iterator which gives 'SeqRecord' objects. Iterators
are typically used in a for loop.
  Sometimes you'll find yourself dealing with files which contain only a
single record. For this situation Biopython 1.45 introduced the function
'Bio.SeqIO.read()'. Again, this takes a handle and format as arguments.
Provided there is one and only one record, this is returned as a
'SeqRecord' object.
  

4.1.1  Reading Sequence Files
=============================
  
  In general 'Bio.SeqIO.parse()' is used to read in sequence files as
'SeqRecord' objects, and is typically used with a for loop like this:
<<from Bio import SeqIO
  handle = open("ls_orchid.fasta")
  for seq_record in SeqIO.parse(handle, "fasta") :
      print seq_record.id
      print repr(seq_record.seq)
      print len(seq_record.seq)
  handle.close()
>>
  
  The above example is repeated from the introduction in Section 2.4,
and will load the orchid DNA sequences in the FASTA format file
ls_orchid.fasta (1). If instead you wanted to load a GenBank format file
like ls_orchid.gbk (2) then all you need to do is change the filename
and the format string:
<<from Bio import SeqIO
  handle = open("ls_orchid.gbk")
  for seq_record in SeqIO.parse(handle, "genbank") :
      print seq_record.id
      print seq_record.seq
      print len(seq_record.seq)
  handle.close()
>>
  
  Similarly, if you wanted to read in a file in another file format,
then assuming 'Bio.SeqIO.parse()' supports it you would just need to
change the format string as appropriate, for example "swiss" for
SwissProt files or "embl" for EMBL text files. There is a full listing
on the wiki page (http://biopython.org/wiki/SeqIO).
  

4.1.2  Iterating over the records in a sequence file
====================================================
  
  In the above examples, we have usually used a for loop to iterate over
all the records one by one. You can use the for loop with all sorts of
Python objects (including lists, tuples and strings) which support the
iteration interface.
  The object returned by 'Bio.SeqIO' is actually an iterator which
returns 'SeqRecord' objects. You get to see each record in turn, but
once and only once. The plus point is that an iterator can save you
memory when dealing with large files.
  Instead of using a for loop, can also use the '.next()' method of an
iterator to step through the entries, like this:
<<from Bio import SeqIO
  handle = open("ls_orchid.fasta")
  record_iterator = SeqIO.parse(handle, "fasta")
  
  first_record = record_iterator.next()
  print first_record.id
  print first_record.description
  
  second_record = record_iterator.next()
  print second_record.id
  print second_record.description
  
  handle.close()
>>
  
  Note that if you try and use '.next()' and there are no more results,
you'll either get back the special Python object 'None' or a
'StopIteration' exception.
  One special case to consider is when your sequence files have multiple
records, but you only want the first one. In this situation the
following code is very concise:
<<from Bio import SeqIO
  first_record  = SeqIO.parse(open("ls_orchid.gbk"), "genbank").next()
>>
  
  A word of warning here -- using the '.next()' method like this will
silently ignore any additional records in the file. If your files have
one and only one record, like some of the online examples later in this
chapter, or a GenBank file for a single chromosome, then use the new
'Bio.SeqIO.read()' function instead. This will check there are no extra
unexpected records present.
  

4.1.3  Getting a list of the records in a sequence file
=======================================================
  
  In the previous section we talked about the fact that
'Bio.SeqIO.parse()' gives you a 'SeqRecord' iterator, and that you get
the records one by one. Very often you need to be able to access the
records in any order. The Python list data type is perfect for this, and
we can turn the record iterator into a list of 'SeqRecord' objects using
the built-in Python function 'list()' like so:
<<from Bio import SeqIO
  handle = open("ls_orchid.gbk")
  records = list(SeqIO.parse(handle, "genbank"))
  handle.close()
  
  print "Found %i records" % len(records)
  
  print "The last record"
  last_record = records[-1] #using Python's list tricks
  print last_record.id
  print repr(last_record.seq)
  print len(last_record.seq)
  
  print "The first record"
  first_record = records[0] #remember, Python counts from zero
  print first_record.id
  print repr(first_record.seq)
  print len(first_record.seq)
>>
  
  Giving:
<<Found 94 records
  The last record
  Z78439.1
  Seq('CATTGTTGAGATCACATAATAATTGATCGAGTTAATCTGGAGGATCTGTTTACT...GCC',
IUPACAmbiguousDNA())
  592
  The first record
  Z78533.1
  Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGATGAGACCGTGG...CGC',
IUPACAmbiguousDNA())
  740
>>
  
  You can of course still use a for loop with a list of 'SeqRecord'
objects. Using a list is much more flexible than an iterator (for
example, you can determine the number of records from the length of the
list), but does need more memory because it will hold all the records in
memory at once.
  

4.1.4  Extracting data
======================
  
  Suppose you wanted to extract a list of the species from the
ls_orchid.gbk (3) GenBank file. Let's have a close look at the first
record in the file and see where the species gets stored:
<<from Bio import SeqIO
  record_iterator = SeqIO.parse(open("ls_orchid.gbk"), "genbank")
  first_record = record_iterator.next()
  print first_record
>>
  
  That should give something like this:
<<ID: Z78533.1
  Name: Z78533
  Desription: C.irapeanum 5.8S rRNA gene and ITS1 and ITS2 DNA.
  /source=Cypripedium irapeanum
  /taxonomy=['Eukaryota', 'Viridiplantae', 'Streptophyta', ...,
'Cypripedium']
  /keywords=['5.8S ribosomal RNA', '5.8S rRNA gene', 'internal
transcribed spacer', 'ITS1', 'ITS2']
  /references=[...]
  /accessions=['Z78533']
  /data_file_division=PLN
  /date=30-NOV-2006
  /organism=Cypripedium irapeanum
  /gi=2765658
  Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGATGAGACCGTGG...CGC',
IUPACAmbiguousDNA())
>>
  
  The information we want, Cypripedium irapeanum, is held in the
annotations dictionary under `source' and `organism', which we can
access like this:
<<print first_record.annotations["source"]
>>
  
  or:
<<print first_record.annotations["organism"]
>>
  
  In general, `organism' is used for the scientific name (in latin, e.g.
Arabidopsis thaliana), while `source' will often be the common name
(e.g. thale cress). In this example, as is often the case, the two
fields are identical. 
  Now let's go through all the records, building up a list of the
species each orchid sequence is from:
<<from Bio import SeqIO
  handle = open("ls_orchid.gbk")
  all_species = []
  for seq_record in SeqIO.parse(handle, "genbank") :
      all_species.append(seq_record.annotations["organism"])
  handle.close()
  print all_species
>>
  
  Another way of writing this code is to use a list comprehension
(introduced in Python 2.0) like this:
<<from Bio import SeqIO
  all_species = [seq_record.annotations["organism"] for seq_record in \
                 SeqIO.parse(open("ls_orchid.gbk"), "genbank")]
  print all_species
>>
  
  In either case, the result is:
<<['Cypripedium irapeanum', 'Cypripedium californicum', ...,
'Paphiopedilum barbatum']
>>
  
  Great. That was pretty easy because GenBank files are annotated in a
standardised way. Now, let's suppose you wanted to extract a list of the
species from your FASTA file, rather than the GenBank file. The bad news
is you will have to write some code to extract the data you want from
the record's description line - if the information is in the file in the
first place!
  For this example, notice that if you break up the description line at
the spaces, then the species is there as field number one (field zero is
the record identifier). That means we can do this:
<<from Bio import SeqIO
  handle = open("ls_orchid.fasta")
  all_species = []
  for seq_record in SeqIO.parse(handle, "fasta") :
      all_species.append(seq_record.description.split()[1])
  handle.close()
  print all_species
>>
  
  This gives:
<<['C.irapeanum', 'C.californicum', 'C.fasciculatum', 'C.margaritaceum',
..., 'P.barbatum']
>>
  
  The concise alternative using list comprehensions (Python 2.0 or
later) would be:
<<from Bio import SeqIO
  all_species == [seq_record.description.split()[1] for seq_record in \
                  SeqIO.parse(open("ls_orchid.fasta"), "fasta")]
  print all_species
>>
  
  In general, extracting information from the FASTA description line is
not very nice. If you can get your sequences in a well annotated file
format like GenBank or EMBL, then this sort of annotation information is
much easier to deal with.
  

4.2  Parsing sequences from the net
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*

    In the previous section, we looked at parsing sequence data from a
file handle. We hinted that handles are not always from files, and in
this section we'll use handles to internet connections to download
sequences.
  Note that just because you can download sequence data and parse it
into a 'SeqRecord' object in one go doesn't mean this is always a good
idea. In general, you should probably download sequences once and save
them to a file for reuse.
  

4.2.1  Parsing GenBank records from the net
===========================================
    Section 7.6 talks about the Entrez EFetch interface in more detail,
but for now let's just connect to the NCBI and get a few orchid proteins
from GenBank using their GI numbers.
  First of all, let's fetch just one record. Remember, when you expect
the handle to contain one and only one record, use the
'Bio.SeqIO.read()' function:
<<from Bio import Entrez
  form Bio import SeqIO
  handle = Entrez.efetch(db="protein", rettype="genbank", id="6273291")
  seq_record = SeqIO.read(handle, "genbank")
  handle.close()
  print "%s with %i features" % (seq_record.id,
len(seq_record.features))
>>
  
  Expected output:
<<gi|6273291|gb|AF191665.1|AF191665 with 3 features
>>
  
  The NCBI will also let you ask for the file in other formats, for
example as a FASTA file. If you don't care about the annotations and
features in a GenBank file, this is a better choice to download because
it's a smaller file:
<<from Bio import Entrez
  form Bio import SeqIO
  handle = Entrez.efetch(db="protein", rettype="fasta", id="6273291")
  seq_record = SeqIO.read(handle, "fasta")
  handle.close()
  print "%s with %i features" % (seq_record.id,
len(seq_record.features))
>>
  
  Expected output:
<<gi|6273291|gb|AF191665.1|AF191665 with 0 features
>>
  
  Now let's fetch several records. This time the handle contains
multiple records, so we must use the 'Bio.SeqIO.parse()' function:
<<from Bio import Entrez
  form Bio import SeqIO
  handle = Entrez.efetch(db="protein", rettype="genbank", \
                         id="6273291,6273290,6273289")
  for seq_record in SeqIO.parse(handle, "genbank") :
      print seq_record.id, seq_record.description[:50] + "..."
      print "Sequence length %i," % len(seq_record),
      print "%i features," % len(seq_record.features),
      print "from: %s" % seq_record.annotations['source']
  handle.close()
>>
  
  That should give the following output:
<<AF191665.1 Opuntia marenae rpl16 gene; chloroplast gene for c...
  Sequence length 902, 3 features, from: chloroplast Opuntia marenae
  AF191664.1 Opuntia clavata rpl16 gene; chloroplast gene for c...
  Sequence length 899, 3 features, from: chloroplast Grusonia clavata
  AF191663.1 Opuntia bradtiana rpl16 gene; chloroplast gene for...
  Sequence length 899, 3 features, from: chloroplast Opuntia bradtianaa
>>
  
  See Chapter 7 for more about the 'Bio.Entrez' module, and make sure to
read about the NCBI guidelines for using Entrez (Section 7.1).
  

4.2.2  Parsing SwissProt sequences from the net
===============================================
    Now let's use a handle to download a SwissProt file from ExPASy,
something covered in more depth in Chapter 8. As mentioned above, the
'Bio.SeqIO.read()' function is included in Biopython 1.45 or later.
<<from Bio import ExPASy
  from Bio import SeqIO
  handle = ExPASy.get_sprot_raw("O23729")
  seq_record = SeqIO.read(handle, "swiss")
  handle.close()
  print seq_record.id
  print seq_record.name
  print seq_record.description
  print repr(seq_record.seq)
  print "Length %i" % len(seq_record)
  print seq_record.annotations['keywords']
>>
  
  Assuming your network connection is OK, you should get back:
<<O23729
  CHS3_BROFI
  Chalcone synthase 3 (EC 2.3.1.74) (Naringenin-chalcone synthase 3).
  Seq('MAPAMEEIRQAQRAEGPAAVLAIGTSTPPNALYQADYPDYYFRITKSEHLTELK...GAE',
ProteinAlphabet())
  Length 394
  ['Acyltransferase', 'Flavonoid biosynthesis', 'Transferase']
>>
  
  

4.3  Sequence files as Dictionaries
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*

  
  The next thing that we'll do with our ubiquitous orchid files is to
show how to index them and access them like a database using the Python
dictionary datatype (like a hash in Perl). This is very useful for large
files where you only need to access certain elements of the file, and
makes for a nice quick 'n dirty database.
  You can use the function 'SeqIO.to_dict()' to make a SeqRecord
dictionary (in memory). By default this will use each record's
identifier (i.e. the '.id' attribute) as the key. Let's try this using
our GenBank file:
<<from Bio import SeqIO
  handle = open("ls_orchid.gbk")
  orchid_dict = SeqIO.to_dict(SeqIO.parse(handle, "genbank"))
  handle.close()
>>
  
  Since this variable 'orchid_dict' is an ordinary Python dictionary, we
can look at all of the keys we have available:
<<>>> print orchid_dict.keys()
  ['Z78484.1', 'Z78464.1', 'Z78455.1', 'Z78442.1', 'Z78532.1',
'Z78453.1', ..., 'Z78471.1']
>>
  
  We can access a single 'SeqRecord' object via the keys and manipulate
the object as normal:
<<>>> seq_record = orchid_dict["Z78475.1"]
  >>> print seq_record.description
  P.supardii 5.8S rRNA gene and ITS1 and ITS2 DNA
  >>> print repr(seq_record.seq)
  Seq('CGTAACAAGGTTTCCGTAGGTGAACCTGCGGAAGGATCATTGTTGAGATCACAT...GGT',
IUPACAmbiguousDNA())
>>
  
  So, it is very easy to create an in memory "database" of our GenBank
records. Next we'll try this for the FASTA file instead.
  

4.3.1  Specifying the dictionary keys
=====================================
  
  Using the same code as above, but for the FASTA file instead:
<<from Bio import SeqIO
  handle = open("ls_orchid.fasta")
  orchid_dict = SeqIO.to_dict(SeqIO.parse(handle, "fasta"))
  handle.close()
  print orchid_dict.keys()
>>
  
  This time the keys are:
<<['gi|2765596|emb|Z78471.1|PDZ78471',
'gi|2765646|emb|Z78521.1|CCZ78521', ...
   ..., 'gi|2765613|emb|Z78488.1|PTZ78488',
'gi|2765583|emb|Z78458.1|PHZ78458']
>>
  
  You should recognise these strings from when we parsed the FASTA file
earlier in Section 2.4.1. Suppose you would rather have something else
as the keys - like the accesion numbers. This brings us nicely to
'SeqIO.to_dict()''s optional argument 'key_function', which lets you
define what to use as the dictionary key for your records.
  First you must write your own function to return the key you want (as
a string) when given a 'SeqRecord' object. In general, the details of
function will depend on the sort of input records you are dealing with.
But for our orchids, we can just split up the record's identifier using
the "pipe" character (the vertical line) and return the fourth entry
(field three):
<<def get_accession(record) :
      """"Given a SeqRecord, return the accession number as a string
    
      e.g. "gi|2765613|emb|Z78488.1|PTZ78488" -> "Z78488.1"
      """
      parts = record.id.split("|")
      assert len(parts) == 5 and parts[0] == "gi" and parts[2] == "emb"
      return parts[3]
>>
  
  Then we can give this function to the 'SeqIO.to_dict()' function to
use in building the dictionary:
<<from Bio import SeqIO
  handle = open("ls_orchid.fasta")
  orchid_dict = SeqIO.to_dict(SeqIO.parse(handle, "fasta"),
key_function=get_accession)
  handle.close()
  print orchid_dict.keys()
>>
  
  Finally, as desired, the new dictionary keys:
<<>>> print orchid_dict.keys()
  ['Z78484.1', 'Z78464.1', 'Z78455.1', 'Z78442.1', 'Z78532.1',
'Z78453.1', ..., 'Z78471.1']
>>
  
  Not too complicated, I hope!
  

4.3.2  Indexing a dictionary using the SEGUID checksum
======================================================
  
  To give another example of working with dictionaries of SeqRecord
objects, we'll use the SEGUID checksum function (added in Biopython
1.44). This is a relatively recent checksum, and collisions should be
very rare (i.e. two different sequences with the same checksum), an
improvement on the CRC64 checksum.
  Once again, working with the orchids GenBank file:
<<from Bio import SeqIO
  from Bio.SeqUtils.CheckSum import seguid
  for record in SeqIO.parse(open("ls_orchid.gbk"), "genbank") :
      print record.id, seguid(record.seq)
>>
  
  This should give:
<<Z78533.1 JUEoWn6DPhgZ9nAyowsgtoD9TTo
  Z78532.1 MN/s0q9zDoCVEEc+k/IFwCNF2pY
  ...
  Z78439.1 H+JfaShya/4yyAj7IbMqgNkxdxQ
>>
  
  Now, recall the 'Bio.SeqIO.to_dict()' function's 'key_function'
argument expects a function which turns a SeqRecord into a string. We
can't use the 'seguid()' function directly because it expects to be
given a Seq object (or a string). However, we can use python's 'lambda'
feature to create a "one off" function to give to 'Bio.SeqIO.to_dict()'
instead:
<<from Bio import SeqIO
  from Bio.SeqUtils.CheckSum import seguid
  seguid_dict = SeqIO.to_dict(SeqIO.parse(open("ls_orchid.gbk"),
"genbank"),
                              lambda rec : seguid(rec.seq))
  record = seguid_dict["MN/s0q9zDoCVEEc+k/IFwCNF2pY"]
  print record.id
  print record.description
>>
  
  That should have retrieved the record Z78532.1, the second entry in
the file.
  

4.4  Writing Sequence Files
*=*=*=*=*=*=*=*=*=*=*=*=*=*

  
  We've talked about using 'Bio.SeqIO.parse()' for sequence input
(reading files), and now we'll look at 'Bio.SeqIO.write()' which is for
sequence output (writing files). This is a function taking three
arguments: some 'SeqRecord' objects, a handle to write to, and a
sequence format.
  Here is an example, where we start by creating a few 'SeqRecord'
objects the hard way (by hand, rather than by loading them from a file):
<<from Bio.Seq import Seq
  from Bio.SeqRecord import SeqRecord
  from Bio.Alphabet import generic_protein
  
  rec1 =
SeqRecord(Seq("MMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPSETHLDSMVGQAL
FGD" \
                     
+"GAGAVIVGSDPDLSVERPLYELVWTGATLLPDSEGAIDGHLREVGLTFHLLKDVPGLISK" \
                     
+"NIEKSLKEAFTPLGISDWNSTFWIAHPGGPAILDQVEAKLGLKEEKMRATREVLSEYGNM" \
                      +"SSAC", generic_protein),
                   id="gi|14150838|gb|AAK54648.1|AF376133_1",
                   description="chalcone synthase [Cucumis sativus]")
  
  rec2 =
SeqRecord(Seq("YPDYYFRITNREHKAELKEKFQRMCDKSMIKKRYMYLTEEILKENPSMCEYMAPSLD
ARQ" \
                      +"DMVVVEIPKLGKEAAVKAIKEWGQ", generic_protein),
                   id="gi|13919613|gb|AAK33142.1|",
                   description="chalcone synthase [Fragaria vesca subsp.
bracteata]")
  
  rec3 =
SeqRecord(Seq("MVTVEEFRRAQCAEGPATVMAIGTATPSNCVDQSTYPDYYFRITNSEHKVELKEKFK
RMC" \
                     
+"EKSMIKKRYMHLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP" \
                     
+"KSKITHLVFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAEN" \
                     
+"NKGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAVIIGSDPIPEVERPLFELV" \
                     
+"SAAQTLLPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFW" \
                     
+"IAHPGGPAILDQVELKLGLKQEKLKATRKVLSNYGNMSSACVLFILDEMRKASAKEGLGT" \
                      +"TGEGLEWGVLFGFGPGLTVETVVLHSVAT",
generic_protein),
                   id="gi|13925890|gb|AAK49457.1|",
                   description="chalcone synthase [Nicotiana tabacum]")
                 
  my_records = [rec1, rec2, rec3]
>>
  
  Now we have a list of 'SeqRecord' objects, we'll write them to a FASTA
format file:
<<from Bio import SeqIO
  handle = open("my_example.faa", "w")
  SeqIO.write(my_records, handle, "fasta")
  handle.close()
>>
  
  And if you open this file in your favourite text editor it should look
like this:
<<>gi|14150838|gb|AAK54648.1|AF376133_1 chalcone synthase [Cucumis
sativus]
  MMYQQGCFAGGTVLRLAKDLAENNRGARVLVVCSEITAVTFRGPSETHLDSMVGQALFGD
  GAGAVIVGSDPDLSVERPLYELVWTGATLLPDSEGAIDGHLREVGLTFHLLKDVPGLISK
  NIEKSLKEAFTPLGISDWNSTFWIAHPGGPAILDQVEAKLGLKEEKMRATREVLSEYGNM
  SSAC
  >gi|13919613|gb|AAK33142.1| chalcone synthase [Fragaria vesca subsp.
bracteata]
  YPDYYFRITNREHKAELKEKFQRMCDKSMIKKRYMYLTEEILKENPSMCEYMAPSLDARQ
  DMVVVEIPKLGKEAAVKAIKEWGQ
  >gi|13925890|gb|AAK49457.1| chalcone synthase [Nicotiana tabacum]
  MVTVEEFRRAQCAEGPATVMAIGTATPSNCVDQSTYPDYYFRITNSEHKVELKEKFKRMC
  EKSMIKKRYMHLTEEILKENPNICAYMAPSLDARQDIVVVEVPKLGKEAAQKAIKEWGQP
  KSKITHLVFCTTSGVDMPGCDYQLTKLLGLRPSVKRFMMYQQGCFAGGTVLRMAKDLAEN
  NKGARVLVVCSEITAVTFRGPNDTHLDSLVGQALFGDGAAAVIIGSDPIPEVERPLFELV
  SAAQTLLPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIEKSLVEAFQPLGISDWNSLFW
  IAHPGGPAILDQVELKLGLKQEKLKATRKVLSNYGNMSSACVLFILDEMRKASAKEGLGT
  TGEGLEWGVLFGFGPGLTVETVVLHSVAT
>>
  
  

4.4.1  Converting between sequence file formats
===============================================
  
  In previous example we used a list of 'SeqRecord' objects as input to
the 'Bio.SeqIO.write()' function, but it will also accept a 'SeqRecord'
interator like we get from 'Bio.SeqIO.parse()' -- this lets us do file
conversion very succinctly. For this example we'll read in the GenBank
format file ls_orchid.gbk (4) and write it out in FASTA format:
<<from Bio import SeqIO
  in_handle = open("ls_orchid.gbk", "r")
  out_handle = open("my_example.fasta", "w")
  SeqIO.write(SeqIO.parse(in_handle, "genbank"), out_handle, "fasta")
  in_handle.close()
  out_handle.close()
>>
  
  You can in fact do this in one line, by being lazy about closing the
file handles. This is arguably bad style, but it is very concise:
<<from Bio import SeqIO
  SeqIO.write(SeqIO.parse(open("ls_orchid.gbk"), "genbank"),
open("my_example.faa", "w"), "fasta")
>>
  
  

4.4.2  Converting a file of sequences to their reverse complements
==================================================================
  
  Suppose you had a file of nucleotide sequences, and you wanted to turn
it into a file containing their reverse complement sequences. This time
a little bit of work is required to transform the SeqRecords we get from
our input file into something suitable for saving to our output file.
  To start with, we'll use 'Bio.SeqIO.parse()' to load some nucleotide
sequences from a file, then print out their reverse complements using
the 'Seq' object's built in '.reverse_complement()' method (see
Section 3.5):
<<from Bio import SeqIO
  in_handle = open("ls_orchid.gbk")
  for record in SeqIO.parse(in_handle, "genbank") :
      print record.id
      print record.seq.reverse_complement().tostring()
  in_handle.close()
>>
  
  Now, if we want to save these reverse complements to a file, we'll
need to make 'SeqRecord' objects. For this I think its most elegant to
write our own function, where we can decide how to name our new records:
<<from Bio.SeqRecord import SeqRecord
  
  def make_rc_record(record) :
      """Returns a new SeqRecord with the reverse complement sequence"""
      rc_rec = SeqRecord(seq = record.seq.reverse_complement(), \
                         id = "rc_" + record.id, \
                         name = "rc_" + record.name, \
                         description = "reverse complement")
      return rc_rec
>>
  
  We can then use this to turn the input records into reverse complement
records ready for output. If you don't mind about having all the records
in memory at once, then the python 'map()' function is a very intuitive
way of doing this:
<<from Bio import SeqIO
  
  in_handle = open("ls_orchid.fasta", "r")
  records = map(make_rc_record, SeqIO.parse(in_handle, "fasta"))
  in_handle.close()
  
  out_handle = open("rev_comp.fasta", "w")
  SeqIO.write(records, out_handle, "fasta")
  out_handle.close()
>>
  
  This is an excellent place to demonstrate the power of list
comprehensions (added to Python 2.0) which in their simplest are a
long-winded equivalent to using 'map()', like this:
<<records = [make_rc_record(rec) for rec in SeqIO.parse(in_handle,
"fasta")]
>>
  
  Now list comprehensions have a nice trick up their sleaves, you can
add a conditional statement:
<<records = [make_rc_record(rec) for rec in SeqIO.parse(in_handle,
"fasta") if len(rec)<700]
>>
  
  That would create an in memory list of reverse complement records
where the sequence length was under 700 base pairs. However, if you are
using Python 2.4 or later, we can do exactly the same with a generator
expression - but with the advantage that this does not create a list of
all the records in memory at once:
<<records = (make_rc_record(rec) for rec in SeqIO.parse(in_handle,
"fasta") if len(rec)<700)
>>
  
  If you like compact code, and don't mind being lax about closing file
handles, we can reduce this to one long line:
<<from Bio import SeqIO
  SeqIO.write((make_rc_record(rec) for rec in \
              SeqIO.parse(open("ls_orchid.fasta", "r"), "fasta") if
len(rec) < 700), \
              open("rev_comp.fasta", "w"), "fasta")
>>
  
  Personally, I think the above snippet of code is a little too compact,
and I find the following much easier to read:
<<from Bio import SeqIO
  records = (make_rc_record(rec) for rec in \
             SeqIO.parse(open("ls_orchid.fasta", "r"), "fasta") \
             if len(rec) < 700)
  SeqIO.write(records, open("rev_comp.fasta", "w"), "fasta")
>>
  
  or, for Python 2.3 or older,
<<from Bio import SeqIO
  records = [make_rc_record(rec) for rec in \
             SeqIO.parse(open("ls_orchid.fasta", "r"), "fasta") \
             if len(rec) < 700]
  SeqIO.write(records, open("rev_comp.fasta", "w"), "fasta")
>>
  
-----------------------------------
  
  
 (1) http://biopython.org/DIST/docs/tutorial/examples/ls_orchid.fasta
 
 (2) http://biopython.org/DIST/docs/tutorial/examples/ls_orchid.gbk
 
 (3) http://biopython.org/DIST/docs/tutorial/examples/ls_orchid.gbk
 
 (4) http://biopython.org/DIST/docs/tutorial/examples/ls_orchid.gbk
  

Chapter 5    Sequence Alignment Input/Output
********************************************
   
  In this chapter we'll discuss the 'Bio.AlignIO' module, which is very
similar to the 'Bio.SeqIO' module from the previous chapter, but deals
with 'Alignment' objects rather than 'SeqRecord' objects.  This is new
interface in Biopython 1.46, which aims to provide a simple interface
for working with assorted sequence alignment file formats in a uniform
way.
  Note that both 'Bio.SeqIO' and 'Bio.AlignIO' can read and write
sequence alignment files. The appropriate choice will depend largely on
what you want to do with the data.
  

5.1  Parsing or Reading Sequence Alignments
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*

  
  We have two functions for reading in sequence alignments,
'Bio.AlignIO.read()' and 'Bio.AlignIO.parse()' which following the
convention introduced in 'Bio.SeqIO' are for files containing one or
multiple alignments respectively.
  Using 'Bio.AlignIO.parse()' will return an iterator which gives
'Alignment' objects. Iterators are typically used in a for loop.
Examples of situations where you will have multiple different alignments
include resampled alignments from the PHYLIP tool 'seqboot', or multiple
pairwise alignments from the EMBOSS tools 'water' or 'needle', or Bill
Pearson's FASTA tools.
  However, in many situations you will be dealing with files which
contain only a single alignment. In this case, you should use the
'Bio.AlignIO.read()' function which return a single 'Alignment' object.
  Both functions expect two mandatory arguments:
  
  
   1. The first argument is a handle to read the data from, typically an
   open file (see Section 12.1). 
   2. The second argument is a lower case string specifying sequence
   coformat. As in 'Bio.SeqIO' we don't try and guess the file format
   for you! See http://biopython.org/wiki/AlignIO for a full listing of
   supported formats. 
  
  There is also an optional 'seq_count' argument which is discussed in
Section 5.1.3 below for dealing with ambigous file formats which may
contain more than one alignment.
  

5.1.1  Single Alignments
========================
   As an example, consider the following annotation rich protein
alignment in the PFAM or Stockholm file format:
<<# STOCKHOLM 1.0
  #=GS COATB_BPIKE/30-81  AC P03620.1
  #=GS COATB_BPIKE/30-81  DR PDB; 1ifl ; 1-52;
  #=GS Q9T0Q8_BPIKE/1-52  AC Q9T0Q8.1
  #=GS COATB_BPI22/32-83  AC P15416.1
  #=GS COATB_BPM13/24-72  AC P69541.1
  #=GS COATB_BPM13/24-72  DR PDB; 2cpb ; 1-49;
  #=GS COATB_BPM13/24-72  DR PDB; 2cps ; 1-49;
  #=GS COATB_BPZJ2/1-49   AC P03618.1
  #=GS Q9T0Q9_BPFD/1-49   AC Q9T0Q9.1
  #=GS Q9T0Q9_BPFD/1-49   DR PDB; 1nh4 A; 1-49;
  #=GS COATB_BPIF1/22-73  AC P03619.2
  #=GS COATB_BPIF1/22-73  DR PDB; 1ifk ; 1-50;
  COATB_BPIKE/30-81            
AEPNAATNYATEAMDSLKTQAIDLISQTWPVVTTVVVAGLVIRLFKKFSSKA
  #=GR COATB_BPIKE/30-81  SS   
-HHHHHHHHHHHHHH--HHHHHHHH--HHHHHHHHHHHHHHHHHHHHH----
  Q9T0Q8_BPIKE/1-52            
AEPNAATNYATEAMDSLKTQAIDLISQTWPVVTTVVVAGLVIKLFKKFVSRA
  COATB_BPI22/32-83            
DGTSTATSYATEAMNSLKTQATDLIDQTWPVVTSVAVAGLAIRLFKKFSSKA
  COATB_BPM13/24-72            
AEGDDP...AKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKA
  #=GR COATB_BPM13/24-72  SS   
---S-T...CHCHHHHCCCCTCCCTTCHHHHHHHHHHHHHHHHHHHHCTT--
  COATB_BPZJ2/1-49             
AEGDDP...AKAAFDSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFASKA
  Q9T0Q9_BPFD/1-49             
AEGDDP...AKAAFDSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKA
  #=GR Q9T0Q9_BPFD/1-49   SS   
------...-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--
  COATB_BPIF1/22-73            
FAADDATSQAKAAFDSLTAQATEMSGYAWALVVLVVGATVGIKLFKKFVSRA
  #=GR COATB_BPIF1/22-73  SS   
XX-HHHH--HHHHHH--HHHHHHH--HHHHHHHHHHHHHHHHHHHHHHH---
  #=GC SS_cons                 
XHHHHHHHHHHHHHHHCHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHC--
  #=GC seq_cons                
AEssss...AptAhDSLpspAT-hIu.sWshVsslVsAsluIKLFKKFsSKA
  //
>>
  
  This is the seed alignment for the Phage_Coat_Gp8 (PF05371) PFAM
entry, downloaded as a compressed archive from
http://pfam.sanger.ac.uk/family/alignment/download/gzipped?acc=PF05371&a
lnType=seed. We can load this file as follows (assuming it has been
saved to disk as "PF05371_seed.sth" in the current working directory):
<<from Bio import AlignIO
  alignment = AlignIO.read(open("PF05371_seed.sth"), "stockholm")
  print alignment
>>
  
  This code will print out a summary of the alignment:
<<SingleLetterAlphabet() alignment with 7 rows and 52 columns
  AEPNAATNYATEAMDSLKTQAIDLISQTWPVVTTVVVAGLVIRL...SKA COATB_BPIKE/30-81
  AEPNAATNYATEAMDSLKTQAIDLISQTWPVVTTVVVAGLVIKL...SRA Q9T0Q8_BPIKE/1-52
  DGTSTATSYATEAMNSLKTQATDLIDQTWPVVTSVAVAGLAIRL...SKA COATB_BPI22/32-83
  AEGDDP---AKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKL...SKA COATB_BPM13/24-72
  AEGDDP---AKAAFDSLQASATEYIGYAWAMVVVIVGATIGIKL...SKA COATB_BPZJ2/1-49
  AEGDDP---AKAAFDSLQASATEYIGYAWAMVVVIVGATIGIKL...SKA Q9T0Q9_BPFD/1-49
  FAADDATSQAKAAFDSLTAQATEMSGYAWALVVLVVGATVGIKL...SRA COATB_BPIF1/22-73
>>
  
  You'll notice in the above output the sequences have been truncated.
We could instead write our own code to format this as we please by
iterating over the rows as 'SeqRecord' objects:
<<from Bio import AlignIO
  alignment = AlignIO.read(open("PF05371_seed.sth"), "stockholm")
  print "Alignment length %i" % alignment.get_alignment_length()
  for record in alignment :
      print "%s - %s" % (record.seq, record.id)
>>
  
  This will give the following output:
<<Alignment length 52
  AEPNAATNYATEAMDSLKTQAIDLISQTWPVVTTVVVAGLVIRLFKKFSSKA -
COATB_BPIKE/30-81
  AEPNAATNYATEAMDSLKTQAIDLISQTWPVVTTVVVAGLVIKLFKKFVSRA -
Q9T0Q8_BPIKE/1-52
  DGTSTATSYATEAMNSLKTQATDLIDQTWPVVTSVAVAGLAIRLFKKFSSKA -
COATB_BPI22/32-83
  AEGDDP---AKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKA -
COATB_BPM13/24-72
  AEGDDP---AKAAFDSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFASKA -
COATB_BPZJ2/1-49
  AEGDDP---AKAAFDSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKA -
Q9T0Q9_BPFD/1-49
  FAADDATSQAKAAFDSLTAQATEMSGYAWALVVLVVGATVGIKLFKKFVSRA -
COATB_BPIF1/22-73
>>
  
  Did you notice in the raw file above that several of the sequences
include database cross-references to the PDB and the associated known
secondary strucutre? Try this:
<<for record in alignment :
      if record.dbxrefs :
          print record.id, record.dbxrefs
>>
  
  giving:
<<COATB_BPIKE/30-81 ['PDB; 1ifl ; 1-52;']
  COATB_BPM13/24-72 ['PDB; 2cpb ; 1-49;', 'PDB; 2cps ; 1-49;']
  Q9T0Q9_BPFD/1-49 ['PDB; 1nh4 A; 1-49;']
  COATB_BPIF1/22-73 ['PDB; 1ifk ; 1-50;']
>>
  
  To have a look at all the sequence annotation, try this:
<<for record in alignment :
      print record
>>
  
  Sanger provide a nice web interface at
http://pfam.sanger.ac.uk/family?acc=PF05371 which will actually let you
download this alignment in several other formats. This is what the file
looks like in the FASTA file format:
<<>COATB_BPIKE/30-81
  AEPNAATNYATEAMDSLKTQAIDLISQTWPVVTTVVVAGLVIRLFKKFSSKA
  >Q9T0Q8_BPIKE/1-52
  AEPNAATNYATEAMDSLKTQAIDLISQTWPVVTTVVVAGLVIKLFKKFVSRA
  >COATB_BPI22/32-83
  DGTSTATSYATEAMNSLKTQATDLIDQTWPVVTSVAVAGLAIRLFKKFSSKA
  >COATB_BPM13/24-72
  AEGDDP...AKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKA
  >COATB_BPZJ2/1-49
  AEGDDP...AKAAFDSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFASKA
  >Q9T0Q9_BPFD/1-49
  AEGDDP...AKAAFDSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKA
  >COATB_BPIF1/22-73
  FAADDATSQAKAAFDSLTAQATEMSGYAWALVVLVVGATVGIKLFKKFVSRA
>>
  
  Assuming you download and save this as file "PF05371_seed.faa" then
you can load it with almost exactly the same code:
<<from Bio import AlignIO
  alignment = AlignIO.read(open("PF05371_seed.faa"), "fasta")
  print alignment
>>
  
  All that has changed in this code is the filename and the format
string. You'll get the same output as before, the sequences and record
identifiers are the same. However, as you should expect, if you check
each 'SeqRecord' there is no annotation nor database cross-references
because these are not included in the FASTA file format.
  Note that rather than using the Sanger website, you could have used
'Bio.AlignIO' to convert the original Stockholm format file into a FASTA
file yourself (see below).
  With any supported file format, you can load an alignment in exactly
the same way just by changing the format string. For example, use
"phylip" for PHYLIP files, "nexus" for NEXUS files or "emboss" for the
alignments output by the EMBOSS tools. There is a full listing on the
wiki page (http://biopython.org/wiki/AlignIO).
  

5.1.2  Multiple Alignments
==========================
  
  The previous section focused on reading files containing a single
alignment. In general however, files can contain more than one
alignment, and to read these files we must use the 'Bio.AlignIO.parse()'
function.
  Suppose you have a small alignment in PHYLIP format:
<<    5    6
  Alpha     AACAAC
  Beta      AACCCC
  Gamma     ACCAAC
  Delta     CCACCA
  Epsilon   CCAAAC
>>
  
  If you wanted to bootstrap a phylogenetic tree using the PHYLIP tools,
one of the steps would be to create a set of many resampled alignments
using the tool 'bootseq'. This would give output something like this,
which has been abbreviated for conciseness:
<<    5     6
  Alpha     AAACCA
  Beta      AAACCC
  Gamma     ACCCCA
  Delta     CCCAAC
  Epsilon   CCCAAA
      5     6
  Alpha     AAACAA
  Beta      AAACCC
  Gamma     ACCCAA
  Delta     CCCACC
  Epsilon   CCCAAA
      5     6
  Alpha     AAAAAC
  Beta      AAACCC
  Gamma     AACAAC
  Delta     CCCCCA
  Epsilon   CCCAAC
  ...
      5     6
  Alpha     AAAACC
  Beta      ACCCCC
  Gamma     AAAACC
  Delta     CCCCAA
  Epsilon   CAAACC
>>
  
  If you wanted to read this in using 'Bio.AlignIO' you could use:
<<from Bio import AlignIO
  alignments = AlignIO.parse(open("resampled.phy"), "phylip")
  for alignment in alignments :
      print alignment
      print
>>
  
  This would give the following output, again abbreviated for display:
<<SingleLetterAlphabet() alignment with 5 rows and 6 columns
  AAACCA Alpha
  AAACCC Beta
  ACCCCA Gamma
  CCCAAC Delta
  CCCAAA Epsilon
  
  SingleLetterAlphabet() alignment with 5 rows and 6 columns
  AAACAA Alpha
  AAACCC Beta
  ACCCAA Gamma
  CCCACC Delta
  CCCAAA Epsilon
  
  SingleLetterAlphabet() alignment with 5 rows and 6 columns
  AAAAAC Alpha
  AAACCC Beta
  AACAAC Gamma
  CCCCCA Delta
  CCCAAC Epsilon
  
  ...
  
  SingleLetterAlphabet() alignment with 5 rows and 6 columns
  AAAACC Alpha
  ACCCCC Beta
  AAAACC Gamma
  CCCCAA Delta
  CAAACC Epsilon
>>
  
  As with the function 'Bio.SeqIO.parse()', using 'Bio.AlignIO.parse()'
returns an iterator. If you want to keep all the alignments in memory at
once, which will allow you to access them in any order, then turn the
iterator into a list:
<<from Bio import AlignIO
  alignments = list(AlignIO.parse(open("resampled.phy"), "phylip"))
  last_align = alignments[-1]
  first_align = alignments[0]
>>
  
  

5.1.3  Ambiguous Alignments
===========================
    Many alignment file formats can explicitly store more than one
alignment, and the division between each alignment is clear. However,
when a general sequence file format has been used there is no such block
structure. The most common such situation is when alignments have been
saved in the FASTA file format. For example consider the following:
<<>Alpha
  ACTACGACTAGCTCAG--G
  >Beta
  ACTACCGCTAGCTCAGAAG
  >Gamma
  ACTACGGCTAGCACAGAAG
  >Alpha
  ACTACGACTAGCTCAGG--
  >Beta
  ACTACCGCTAGCTCAGAAG
  >Gamma
  ACTACGGCTAGCACAGAAG
>>
  
  This could be a single alignment containing six sequences (with
repeated identifiers). Or, judging from the identifiers, this is
probably two different alignments each with three sequences, which
happen to all have the same length.
  What about this next example?
<<>Alpha
  ACTACGACTAGCTCAG--G
  >Beta
  ACTACCGCTAGCTCAGAAG
  >Alpha
  ACTACGACTAGCTCAGG--
  >Gamma
  ACTACGGCTAGCACAGAAG
  >Alpha
  ACTACGACTAGCTCAGG--
  >Delta
  ACTACGGCTAGCACAGAAG
>>
  
  Again, this could be a single alignment with six sequences. However
this time based on the identifiers we might guess this is three pairwise
alignments which by chance have all got the same lengths.
  This final example is similar:
<<>Alpha
  ACTACGACTAGCTCAG--G
  >XXX
  ACTACCGCTAGCTCAGAAG
  >Alpha
  ACTACGACTAGCTCAGG
  >YYY
  ACTACGGCAAGCACAGG
  >Alpha
  --ACTACGAC--TAGCTCAGG
  >ZZZ
  GGACTACGACAATAGCTCAGG
>>
  
  In this third example, because of the differing lengths, this cannot
be treated as a single alignment containing all six records. However, it
could be three pairwise alignments.
  Clearly trying to store more than one alignment in a FASTA file is not
ideal. However, if you are forced to deal with these as input files
'Bio.AlignIO' can cope with the most common situation where all the
alignments have the same number of records. One example of this is a
collection of pairwise alignments, which can be produced by the EMBOSS
tools 'needle' and 'water' -- although in this situation, 'Bio.AlignIO'
should be able to understand their native output using "emboss" as the
format string.
  To interpret these FASTA examples as several separate alignments, we
can use 'Bio.AlignIO.parse()' with the optional 'seq_count' argument
which specifies how many sequences are expected in each alignment (in
these examples, 3, 2 and 2 respectively). For example, using the third
example as the input data:
<<for alignment in AlignIO.parse(handle, "fasta", seq_count=2) :
      print "Alignment length %i" % alignment.get_alignment_length()
      for record in alignment :
          print "%s - %s" % (record.seq, record.id)
      print
>>
  
  giving:
<<Alignment length 19
  ACTACGACTAGCTCAG--G - Alpha
  ACTACCGCTAGCTCAGAAG - XXX
  
  Alignment length 17
  ACTACGACTAGCTCAGG - Alpha
  ACTACGGCAAGCACAGG - YYY
  
  Alignment length 21
  --ACTACGAC--TAGCTCAGG - Alpha
  GGACTACGACAATAGCTCAGG - ZZZ
>>
  
  Using 'Bio.AlignIO.read()' or 'Bio.AlignIO.parse()' without the
'seq_count' argument would give a single alignment containing all six
records for the first two examples. For the third example, an exception
would be raised because the lengths differ preventing them being turned
into a single alignment.
  If the file format itself has a block structure allowing 'Bio.AlignIO'
to determine the number of sequences in each alignment directly, then
the 'seq_count' argument is not needed. If it is supplied, and doesn't
agree with the file contents, an error is raised.
  Note that this optional 'seq_count' argument assumes each alignment in
the file has the same number of sequences. Hypothetically you may come
across stranger situations, for example a FASTA file containing several
alignments each with a different number of sequences -- although I would
love to hear of a real world example of this. Assuming you cannot get
the data in a nicer file format, there is no straight forward way to
deal with this using 'Bio.AlignIO'. In this case, you could consider
reading in the sequences themselves using 'Bio.SeqIO' and batching them
together to create the alignments as appropriate.
  

5.2  Writing Alignments
*=*=*=*=*=*=*=*=*=*=*=*

  
  We've talked about using 'Bio.AlignIO.read()' and
'Bio.AlignIO.parse()' for alignment input (reading files), and now we'll
look at 'Bio.AlignIO.write()' which is for alignment output (writing
files). This is a function taking three arguments: some 'Alignment'
objects, a handle to write to, and a sequence format.
  Here is an example, where we start by creating a few 'Alignment'
objects the hard way (by hand, rather than by loading them from a file):
<<from Bio.Align.Generic import Alignment
  from Bio.Alphabet import IUPAC, Gapped
  alphabet = Gapped(IUPAC.unambiguous_dna)
  
  align1 = Alignment(alphabet)
  align1.add_sequence("Alpha", "ACTGCTAGCTAG")
  align1.add_sequence("Beta",  "ACT-CTAGCTAG")
  align1.add_sequence("Gamma", "ACTGCTAGDTAG")
  
  align2 = Alignment(alphabet)
  align2.add_sequence("Delta",  "GTCAGC-AG")
  align2.add_sequence("Epislon","GACAGCTAG")
  align2.add_sequence("Zeta",   "GTCAGCTAG")
  
  align3 = Alignment(alphabet)
  align3.add_sequence("Eta",   "ACTAGTACAGCTG")
  align3.add_sequence("Theta", "ACTAGTACAGCT-")
  align3.add_sequence("Iota",  "-CTACTACAGGTG")
  
  my_alignments = [align1, align2, align3]
>>
  
  Now we have a list of 'Alignment' objects, we'll write them to a
PHYLIP format file:
<<from Bio import AlignIO
  handle = open("my_example.phy", "w")
  SeqIO.write(my_alignments, handle, "phylip")
  handle.close()
>>
  
  And if you open this file in your favourite text editor it should look
like this:
<< 3 12
  Alpha      ACTGCTAGCT AG
  Beta       ACT-CTAGCT AG
  Gamma      ACTGCTAGDT AG
   3 9
  Delta      GTCAGC-AG
  Epislon    GACAGCTAG
  Zeta       GTCAGCTAG
   3 13
  Eta        ACTAGTACAG CTG
  Theta      ACTAGTACAG CT-
  Iota       -CTACTACAG GTG
>>
  
  Its more common to want to load an existing alignment, and save that,
perhaps after some simple manipulation like removing certain rows or
columns.
  

5.2.1  Converting between sequence alignment file formats
=========================================================
   
  Converting between sequence alignment file formats with 'Bio.AlignIO'
works in the same way as converting between sequence file formats with
'Bio.SeqIO' -- we load generally the alignment(s) using
'Bio.AlignIO.parse()' and then save them using the
'Bio.AlignIO.write()'.
  For this example, we'll load the PFAM/Stockholm format file used
earlier and save it as a Clustal W format file:
<<from Bio import AlignIO
  alignments = AlignIO.parse(open("PF05371_seed.sth"), "stockholm")
  handle = open("PF05371_seed.aln","w")
  AlignIO.write(alignments, handle, "clustal")
  handle.close()
>>
  
  The 'Bio.AlignIO.write()' function expects to be given multiple
alignment objects. In the example above we gave it the alignment
iterator returned by 'Bio.AlignIO.parse()'.
  In this case, we know there is only one alignment in the file so we
could instead have used 'Bio.AlignIO.read()' but notice we have to pass
this alignment to 'Bio.AlignIO.write()' as a single element list:
<<from Bio import AlignIO
  alignment = AlignIO.read(open("PF05371_seed.sth"), "stockholm")
  handle = open("PF05371_seed.aln","w")
  AlignIO.write([alignment], handle, "clustal")
  handle.close()
>>
  
  Either way, you should end up with the same new Clustal W format file
"PF05371_seed.aln"" with the following content:
<<CLUSTAL X (1.81) multiple sequence alignment
  
  
  COATB_BPIKE/30-81                  
AEPNAATNYATEAMDSLKTQAIDLISQTWPVVTTVVVAGLVIRLFKKFSS
  Q9T0Q8_BPIKE/1-52                  
AEPNAATNYATEAMDSLKTQAIDLISQTWPVVTTVVVAGLVIKLFKKFVS
  COATB_BPI22/32-83                  
DGTSTATSYATEAMNSLKTQATDLIDQTWPVVTSVAVAGLAIRLFKKFSS
  COATB_BPM13/24-72                  
AEGDDP---AKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTS
  COATB_BPZJ2/1-49                   
AEGDDP---AKAAFDSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFAS
  Q9T0Q9_BPFD/1-49                   
AEGDDP---AKAAFDSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTS
  COATB_BPIF1/22-73                  
FAADDATSQAKAAFDSLTAQATEMSGYAWALVVLVVGATVGIKLFKKFVS
  
  COATB_BPIKE/30-81                   KA
  Q9T0Q8_BPIKE/1-52                   RA
  COATB_BPI22/32-83                   KA
  COATB_BPM13/24-72                   KA
  COATB_BPZJ2/1-49                    KA
  Q9T0Q9_BPFD/1-49                    KA
  COATB_BPIF1/22-73                   RA
>>
  
  Alternatively, you could make a PHYLIP format file which we'll name
"PF05371_seed.phy":
<<from Bio import AlignIO
  alignment = AlignIO.read(open("PF05371_seed.sth"), "stockholm")
  handle = open("PF05371_seed.phy","w")
  AlignIO.write([alignment], handle, "phylip")
  handle.close()
>>
  
  This time the output looks like this:
<< 7 52
  COATB_BPIK AEPNAATNYA TEAMDSLKTQ AIDLISQTWP VVTTVVVAGL VIRLFKKFSS
  Q9T0Q8_BPI AEPNAATNYA TEAMDSLKTQ AIDLISQTWP VVTTVVVAGL VIKLFKKFVS
  COATB_BPI2 DGTSTATSYA TEAMNSLKTQ ATDLIDQTWP VVTSVAVAGL AIRLFKKFSS
  COATB_BPM1 AEGDDP---A KAAFNSLQAS ATEYIGYAWA MVVVIVGATI GIKLFKKFTS
  COATB_BPZJ AEGDDP---A KAAFDSLQAS ATEYIGYAWA MVVVIVGATI GIKLFKKFAS
  Q9T0Q9_BPF AEGDDP---A KAAFDSLQAS ATEYIGYAWA MVVVIVGATI GIKLFKKFTS
  COATB_BPIF FAADDATSQA KAAFDSLTAQ ATEMSGYAWA LVVLVVGATV GIKLFKKFVS
  
             KA
             RA
             KA
             KA
             KA
             KA
             RA
>>
  
  One of the big handicaps of the PHYLIP alignment file format is that
the sequence identifiers are strictly truncated at ten characters. In
this example, as you can see the resulting names are still unique - but
they are not very readable. In this particular case, there is no clear
way to compress the identifers, but for the sake of argument you may
want to assign your own names or numbering system. This following bit of
code manipulates the record identifiers before saving the output:
<<from Bio import AlignIO
  alignment = AlignIO.read(open("PF05371_seed.sth"), "stockholm")
  name_mapping = {}
  for i, record in enumerate(alignment) :
      name_mapping[i] = record.id
      record.id = "seq%i" % i
  print name_mapping
  
  handle = open("PF05371_seed.phy","w")
  AlignIO.write([alignment], handle, "phylip")
  handle.close()
>>
  
  This code using a python dictionary to record a simple mapping from
the new sequence system to the original identifier: 
<<{0: 'COATB_BPIKE/30-81', 1: 'Q9T0Q8_BPIKE/1-52', 2:
'COATB_BPI22/32-83', ...}
>>
  
  Here is the new PHYLIP format output: 
<< 7 52
  seq0       AEPNAATNYA TEAMDSLKTQ AIDLISQTWP VVTTVVVAGL VIRLFKKFSS
  seq1       AEPNAATNYA TEAMDSLKTQ AIDLISQTWP VVTTVVVAGL VIKLFKKFVS
  seq2       DGTSTATSYA TEAMNSLKTQ ATDLIDQTWP VVTSVAVAGL AIRLFKKFSS
  seq3       AEGDDP---A KAAFNSLQAS ATEYIGYAWA MVVVIVGATI GIKLFKKFTS
  seq4       AEGDDP---A KAAFDSLQAS ATEYIGYAWA MVVVIVGATI GIKLFKKFAS
  seq5       AEGDDP---A KAAFDSLQAS ATEYIGYAWA MVVVIVGATI GIKLFKKFTS
  seq6       FAADDATSQA KAAFDSLTAQ ATEMSGYAWA LVVLVVGATV GIKLFKKFVS
  
             KA
             RA
             KA
             KA
             KA
             KA
             RA
>>
  
  In general, because of the identifier limitation, working with PHYLIP
file formats shouldn't be your first choice. Using the PFAM/Stockholm
format on the other hand allows you to record a lot of additional
annotation too.
  

Chapter 6    BLAST
******************
    Hey, everybody loves BLAST right? I mean, geez, how can get it get
any easier to do comparisons between one of your sequences and every
other sequence in the known world? But, of course, this section isn't
about how cool BLAST is, since we already know that. It is about the
problem with BLAST -- it can be really difficult to deal with the volume
of data generated by large runs, and to automate BLAST runs in general.
  Fortunately, the Biopython folks know this only too well, so they've
developed lots of tools for dealing with BLAST and making things much
easier. This section details how to use these tools and do useful things
with them.
  Dealing with BLAST can be split up into two steps, both of which can
be done from within Biopython. Firstly, running BLAST for your query
sequence(s), and getting some output. Secondly, parsing the BLAST output
in python for further analysis. We'll start by talking about running the
BLAST command line tools locally, and then discuss running BLAST via the
web.
  

6.1  Running BLAST locally
*=*=*=*=*=*=*=*=*=*=*=*=*=

   
  Running BLAST locally (as opposed to over the internet, see
Section 6.2) has two advantages: 
  
   - Local BLAST may be faster than BLAST over the internet; 
   - Local BLAST allows you to make your own database to search for
   sequences against. 
   Dealing with proprietary or unpublished sequence data can be another
reason to run BLAST locally. You may not be allowed to redistribute the
sequences, so submitting them to the NCBI as a BLAST query would not be
an option.
  Biopython provides lots of nice code to enable you to call local BLAST
executables from your scripts, and have full access to the many command
line options that these executables provide. You can obtain local BLAST
precompiled for a number of platforms at
ftp://ftp.ncbi.nlm.nih.gov/blast/executables/, or can compile it
yourself in the NCBI toolbox (ftp://ftp.ncbi.nlm.nih.gov/toolbox/).
  The code for dealing with local BLAST is found in
'Bio.Blast.NCBIStandalone', specifically in the functions 'blastall',
'blastpgp' and 'rpsblast', which correspond with the BLAST executables
that their names imply.
  Let's use these functions to run a 'blastall' against a local database
and return the results. First, we want to set up the paths to everything
that we'll need to do the BLAST. What we need to know is the path to the
database (which should have been prepared using 'formatdb', see
ftp://ftp.ncbi.nlm.nih.gov/blast/documents/formatdb.html) to search
against, the path to the file we want to search, and the path to the
'blastall' executable.
  On Linux or Mac OS X your paths might look like this:
<<>>> my_blast_db = "/home/mdehoon/Data/Genomes/Databases/bsubtilis"
  # I used formatdb to create a BLAST database named bsubtilis
  # (for Bacillus subtilis) consisting of the following three files:
  # /home/mdehoon/Data/Genomes/Databases/bsubtilis.nhr
  # /home/mdehoon/Data/Genomes/Databases/bsubtilis.nin
  # /home/mdehoon/Data/Genomes/Databases/bsubtilis.nsq
  
  >>> my_blast_file = "m_cold.fasta"
  # A FASTA file with the sequence I want to BLAST
  
  >>> my_blast_exe = "/usr/local/blast/bin/blastall"
  # The name of my BLAST executable
>>
  
  while on Windows you might have something like this:
<<>>> my_blast_db = r"C:\Blast\Data\bsubtilis"
  # Assuming you used formatdb to create a BLAST database named
bsubtilis
  # (for Bacillus subtilis) consisting of the following three files:
  # C:\Blast\Data\bsubtilis\bsubtilis.nhr
  # C:\Blast\Data\bsubtilis\bsubtilis.nin
  # C:\Blast\Data\bsubtilis\bsubtilis.nsq
  >>> my_blast_file = "m_cold.fasta"
  >>> my_blast_exe =r"C:\Blast\bin\blastall.exe"
>>
  
  The FASTA file used in this example is available here (1) as well as
online (2).
  Now that we've got that all set, we are ready to run the BLAST and
collect the results. We can do this with two lines:
<<>>> from Bio.Blast import NCBIStandalone
  >>> result_handle, error_handle =
NCBIStandalone.blastall(my_blast_exe, "blastn",
                                                      my_blast_db,
my_blast_file)
>>
  
  Note that the Biopython interfaces to local blast programs returns two
values. The first is a handle to the blast output, which is ready to
either be saved or passed to a parser. The second is the possible error
output generated by the blast command. See Section 12.1 for more about
handles.
  The error info can be hard to deal with, because if you try to do a
'error_handle.read()' and there was no error info returned, then the
'read()' call will block and not return, locking your script. In my
opinion, the best way to deal with the error is only to print it out if
you are not getting 'result_handle' results to be parsed, but otherwise
to leave it alone.
  This command will generate BLAST output in XML format, as that is the
format expected by the XML parser, described in Section 6.4. For plain
text output, use the 'align_view='0'' keyword. To parse text output
instead of XML output, see the Section 6.6 below. However, parsing text
output is not recommended, as the BLAST plain text output changes
frequently, breaking our parsers.
  If you are interested in saving your results to a file before parsing
them, see Section 6.3. To find out how to parse the BLAST results, go to
Section 6.4
  

6.2  Running BLAST over the Internet
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=

   
  The first step in automating BLASTing is to make everything accessible
from Python scripts. So, Biopython contains code that allows you to run
the WWW version of BLAST (http://www.ncbi.nlm.nih.gov/BLAST/) directly
from your Python scripts. This is very nice, especially since otherwise
BLAST can be a real pain to deal with from scripts, especially with the
whole BLAST queue thing and the separate results page.
  The code to deal with the WWW version of BLAST is found in the
'Bio.Blast.NCBIWWW' module, and the 'qblast' function. Let's say we want
to BLAST info we have in a FASTA formatted file against the database.
First, we need to get the info in the FASTA file.
  The easiest way to do this is to use the 'Bio.SeqIO' module (see
Chapter 4). In this example we'll use the 'Bio.SeqIO.read' function to
turn a FASTA file containing a single entry into a SeqRecord object:
<<>>> from Bio import SeqIO
  >>> record = SeqIO.read(open("m_cold.fasta"), format="fasta")
>>
  
  Now we can take the sequence as a plain string from the SeqRecord and
run BLAST on it. The code to do the simplest possible BLAST (a simple
blastn of the FASTA file against all of the non-redundant databases) is:
<<>>> from Bio.Blast import NCBIWWW
  >>> result_handle = NCBIWWW.qblast("blastn", "nr",
record.seq.tostring())
>>
  
  The first three arguments to our 'NCBIWWW.qblast' function are
non-optional:
  
  
   - The first argument is the blast program to use for the search, as a
   lower case string. The options and descriptions of the programs are
   available at http://www.ncbi.nlm.nih.gov/BLAST/blast_program.html.
   Currently 'qblast' only works with blastn, blastp, blastx, tblast and
   tblastx. 
   - The second argument specifies the databases to search against.
   Again, the options for this are available on the NCBI web pages at
   http://www.ncbi.nlm.nih.gov/BLAST/blast_databases.html. 
   - The third argument is a string containing your query sequence. This
   can either be the sequence itself (as above), the sequence in fasta
   format, or an identifier like a GI number. 
  
  The 'qblast' function also take a number of other option arguments
which are basically analogous to the different parameters you can set on
the BLAST web page. We'll just highlight a few of them here:
  
  
   - The 'qblast' function can return the BLAST results in various
   formats, which you can choose with the optional 'format_type'
   keyword: '"HTML"', '"Text"', '"ASN.1"', or '"XML"'. The default is
   '"XML"', as that is the format expected by the parser, described in
   section 6.4 below. 
   - The argument 'expect' sets the expectation or e-value threshold. 
  
  For more about the optional BLAST arguments, we refer you to the
NCBI's own documentation, or that built into Biopython:
<<>>> from Bio.Blast import NCBIWWW
  >>> help(NCBIWWW.qblast)
>>
  
  After you have set the search options, you are all ready to BLAST.
Biopython takes care of worrying about when the results are available,
and will pause until it can get the results and return them.
  

6.3  Saving BLAST output
*=*=*=*=*=*=*=*=*=*=*=*=

   
  Before parsing the results, it is often useful to save them into a
file so that you can use them later without having to go back and
re-blast everything. I find this especially useful when debugging my
code that extracts info from the BLAST files, but it could also be
useful just for making backups of things you've done.
  If you don't want to save the BLAST output, you can skip to
section 6.4. If you do, read on.
  We need to be a bit careful since we can use 'result_handle.read()' to
read the BLAST output only once -- calling 'result_handle.read()' again
returns an empty string. First, we use 'read()' and store all of the
information from the handle into a string:
<<>>> blast_results = result_handle.read()
>>
  
  Next, we save this string in a file:
<<>>> save_file = open("my_blast.xml", "w")
  >>> save_file.write(blast_results)
  >>> save_file.close()
>>
  
  After doing this, the results are in the file 'my_blast.xml' and the
variable 'blast_results' contains the BLAST results in a string form.
However, the 'parse' function of the BLAST parser (described in 6.4)
takes a file-handle-like object, not a plain string. To get a handle,
there are two things you can do: 
  
   - Use the Python standard library module 'cStringIO'. The following
   code will turn the plain string into a handle, which we can feed
   directly into the BLAST parser: 
   <<>>> import cStringIO
     >>> result_handle = cStringIO.StringIO(blast_results)
   >>
 
   - Open the saved file for reading. Duh. 
   <<>>> result_handle = open("my_blast.xml")
   >>
  
  Now that we've got the BLAST results, we are ready to do something
with them, so this leads us right into the parsing section.
  

6.4  Parsing BLAST output
*=*=*=*=*=*=*=*=*=*=*=*=*

   
  As mentioned above, BLAST can generate output in various formats, such
as XML, HTML, and plain text. Originally, Biopython had a parser for
BLAST plain text and HTML output, as these were the only output formats
supported by BLAST. Unfortunately, the BLAST output in these formats
kept changing, each time breaking the Biopython parsers. As keeping up
with changes in BLAST became a hopeless endeavor, especially with users
running different BLAST versions, we now recommend to parse the output
in XML format, which can be generated by recent versions of BLAST. Not
only is the XML output more stable than the plain text and HTML output,
it is also much easier to parse automatically, making Biopython a whole
lot more stable.
  Though deprecated, the parsers for BLAST output in plain text or HTML
output are still available in Biopython (see Section 6.6). Use them at
your own risk: they may or may not work, depending on which BLAST
version you're using.
  You can get BLAST output in XML format in various ways. For the
parser, it doesn't matter how the output was generated, as long as it is
in the XML format. 
  
   - You can use Biopython to run BLAST locally, as described in
   section 6.1. 
   - You can use Biopython to run BLAST over the internet, as described
   in section 6.2. 
   - You can do the BLAST seach yourself on the NCBI site through your
   web browser, and then save the results. You need to choose XML as the
   format in which to receive the results, and save the final BLAST page
   you get (you know, the one with all of the interesting results!) to a
   file. 
   - You can also run BLAST locally without using Biopython, and save
   the output in a file. Again, you need to choose XML as the format in
   which to receive the results. 
   The important point is that you do not have to use Biopython scripts
to fetch the data in order to be able to parse it.
  Doing things in one of these ways, you then need to get a handle to
the results. In Python, a handle is just a nice general way of
describing input to any info source so that the info can be retrieved
using 'read()' and 'readline()' functions. This is the type of input the
BLAST parser (and most other Biopython parsers) take.
  If you followed the code above for interacting with BLAST through a
script, then you already have 'result_handle', the handle to the BLAST
results. For example:
<<>>> from Bio import SeqIO
  >>> record = SeqIO.read(open("m_cold.fasta"), format="fasta")
  >>> from Bio.Blast import NCBIWWW
  >>> result_handle = NCBIWWW.qblast("blastn", "nr",
record.seq.tostring())
>>
  
  If instead you ran BLAST some other way, and have the BLAST output (in
XML format) in the file 'my_blast.xml', all you need to do is to open
the file for reading:
<<>>> result_handle = open("my_blast.xml")
>>
  
  Now that we've got a handle, we are ready to parse the output. The
code to parse it is really quite small:
<<>>> from Bio.Blast import NCBIXML
  >>> blast_records = NCBIXML.parse(result_handle)
>>
  
  To understand what 'NCBIXML.parse' returns, there are two things that
you need to keep in mind: 
  
   - The BLAST output may contain the output of more than one BLAST
   search. This will for example be the case if you ran BLAST locally on
   a Fasta file containing more than one sequence. For each sequence,
   the BLAST parser will return one BLAST record. 
   - The BLAST output may therefore be huge. 
  
  To be able to handle these situations, 'NCBIXML.parse' returns an
iterator (just like 'Bio.SeqIO.parse'). In plain English, an iterator
allows you to step through the BLAST output, retrieving BLAST records
one by one for each BLAST search:
<<>>> blast_record = blast_records.next()
  # ... do something with blast_record
  >>> blast_record = blast_records.next()
  # ... do something with blast_record
  >>> blast_record = blast_records.next()
  # ... do something with blast_record
  >>> blast_record = blast_records.next()
  Traceback (most recent call last):
    File "<stdin>", line 1, in <module>
  StopIteration
  # No further records
>>
  
  Or, you can use a 'for'-loop: 
<<>>> for blast_record in blast_records:
  ...     # Do something with blast_record
>>
  
  Note though that you can step through the BLAST records only once.
Usually, from each BLAST record you would save the information that you
are interested in. If you want to save all returned BLAST records, you
can convert the iterator into a list: 
<<>>> blast_records = list(blast_records)
>>
  Now you can access each BLAST record in the list with an index as
usual. If your BLAST file is huge though, you may run into problems
trying to save them all in a list.
  Usually, you'll be running one BLAST search at a time. Then, all you
need to do is to pick up the first (and only) BLAST record in
'blast_records': 
<<>>> blast_record = blast_records.next()
>>
  
  I guess by now you're wondering what is in a BLAST record.
  

6.5  The BLAST record class
*=*=*=*=*=*=*=*=*=*=*=*=*=*

  
  A BLAST Record contains everything you might ever want to extract from
the BLAST output. Right now we'll just show an example of how to get
some info out of the BLAST report, but if you want something in
particular that is not described here, look at the info on the record
class in detail, and take a gander into the code or automatically
generated documentation -- the docstrings have lots of good info about
what is stored in each piece of information.
  To continue with our example, let's just print out some summary info
about all hits in our blast report greater than a particular threshold.
The following code does this:
<<>>> E_VALUE_THRESH = 0.04
  
  >>> for alignment in blast_record.alignments:
  ...     for hsp in alignment.hsps:
  ...         if hsp.expect < E_VALUE_THRESH:
  ...             print '****Alignment****'
  ...             print 'sequence:', alignment.title
  ...             print 'length:', alignment.length
  ...             print 'e value:', hsp.expect
  ...             print hsp.query[0:75] + '...'
  ...             print hsp.match[0:75] + '...'
  ...             print hsp.sbjct[0:75] + '...'
>>
  
  This will print out summary reports like the following:
<<****Alignment****
  sequence: >gb|AF283004.1|AF283004 Arabidopsis thaliana cold
acclimation protein WCOR413-like protein
  alpha form mRNA, complete cds
  length: 783
  e value: 0.034
  tacttgttgatattggatcgaacaaactggagaaccaacatgctcacgtcacttttagtcccttacatat
tcctc...
  ||||||||| | ||||||||||| || ||||  || || |||||||| |||||| |  | ||||||||
||| ||...
  tacttgttggtgttggatcgaaccaattggaagacgaatatgctcacatcacttctcattccttacatct
tcttc...
>>
  
  Basically, you can do anything you want to with the info in the BLAST
report once you have parsed it. This will, of course, depend on what you
want to use it for, but hopefully this helps you get started on doing
what you need to do!
  An important consideration for extracting information from a BLAST
report is the type of objects that the information is stored in. In
Biopython, the parsers return 'Record' objects, either 'Blast' or
'PSIBlast' depending on what you are parsing. These objects are defined
in 'Bio.Blast.Record' and are quite complete.
  Here are my attempts at UML class diagrams for the 'Blast' and
'PSIBlast' record classes. If you are good at UML and see
mistakes/improvements that can be made, please let me know. The Blast
class diagram is shown in Figure 6.5.
    *images/BlastRecord.png* 
  
  The PSIBlast record object is similar, but has support for the rounds
that are used in the iteration steps of PSIBlast. The class diagram for
PSIBlast is shown in Figure 6.5.
    *images/PSIBlastRecord.png* 
  
  

6.6  Deprecated BLAST parsers
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*

   
  Older versions of Biopython had parsers for BLAST output in plain text
or HTML format. Over the years, we discovered that it is very hard to
maintain these parsers in working order. Basically, any small change to
the BLAST output in newly released BLAST versions tends to cause the
plain text and HTML parsers to break. We therefore recommend parsing
BLAST output in XML format, as described in section 6.4. Whereas the
plain text and HTML parsers are still available in Biopython, use them
at your own risk. They may or may not work, depending on which BLAST
versions you're using.
  

6.6.1  Parsing plain-text BLAST output
======================================
  
  The plain text BLAST parser is located in 'Bio.Blast.NCBIStandalone'.
  As with the XML parser, we need to have a handle object that we can
pass to the parser. The handle must implement the 'readline()' method
and do this properly. The common ways to get such a handle are to either
use the provided 'blastall' or 'blastpgp' functions to run the local
blast, or to run a local blast via the command line, and then do
something like the following:
<<>>> result_handle = open("my_file_of_blast_output.txt")
>>
  
  Well, now that we've got a handle (which we'll call 'result_handle'),
we are ready to parse it. This can be done with the following code:
<<>>> from Bio.Blast import NCBIStandalone
  >>> blast_parser = NCBIStandalone.BlastParser()
  >>> blast_record = blast_parser.parse(result_handle)
>>
  
  This will parse the BLAST report into a Blast Record class (either a
Blast or a PSIBlast record, depending on what you are parsing) so that
you can extract the information from it. In our case, let's just use
print out a quick summary of all of the alignments greater than some
threshold value.
<<>>> E_VALUE_THRESH = 0.04
  >>> for alignment in b_record.alignments:
  ...     for hsp in alignment.hsps:
  ...         if hsp.expect < E_VALUE_THRESH:
  ...             print '****Alignment****'
  ...             print 'sequence:', alignment.title
  ...             print 'length:', alignment.length
  ...             print 'e value:', hsp.expect
  ...             print hsp.query[0:75] + '...'
  ...             print hsp.match[0:75] + '...'
  ...             print hsp.sbjct[0:75] + '...'
>>
  
  If you also read the section 6.4 on parsing BLAST XML output, you'll
notice that the above code is identical to what is found in that
section. Once you parse something into a record class you can deal with
it independent of the format of the original BLAST info you were
parsing. Pretty snazzy!
  Sure, parsing one record is great, but I've got a BLAST file with tons
of records -- how can I parse them all? Well, fear not, the answer lies
in the very next section.
  

6.6.2  Parsing a file full of BLAST runs
========================================
  
  Of course, local blast is cool because you can run a whole bunch of
sequences against a database and get back a nice report on all of it.
So, Biopython definitely has facilities to make it easy to parse
humongous files without memory problems.
  We can do this using the blast iterator. To set up an iterator, we
first set up a parser, to parse our blast reports in Blast Record
objects:
<<>>> from Bio.Blast import NCBIStandalone
  >>> blast_parser = NCBIStandalone.BlastParser()
>>
  
  Then we will assume we have a handle to a bunch of blast records,
which we'll call 'result_handle'. Getting a handle is described in full
detail above in the blast parsing sections.
  Now that we've got a parser and a handle, we are ready to set up the
iterator with the following command:
<<>>> blast_iterator = NCBIStandalone.Iterator(blast_handle,
blast_parser)
>>
  
  The second option, the parser, is optional. If we don't supply a
parser, then the iterator will just return the raw BLAST reports one at
a time.
  Now that we've got an iterator, we start retrieving blast records
(generated by our parser) using 'next()':
<<>>> blast_record = blast_iterator.next()
>>
  
  Each call to next will return a new record that we can deal with. Now
we can iterate through this records and generate our old favorite, a
nice little blast report:
<<>>> for b_record in b_iterator :
  ...     E_VALUE_THRESH = 0.04
  ...     for alignment in b_record.alignments:
  ...         for hsp in alignment.hsps:
  ...             if hsp.expect < E_VALUE_THRESH:
  ...                 print '****Alignment****'
  ...                 print 'sequence:', alignment.title
  ...                 print 'length:', alignment.length
  ...                 print 'e value:', hsp.expect
  ...                 if len(hsp.query) > 75:
  ...                     dots = '...'
  ...                 else:
  ...                     dots = ''
  ...                 print hsp.query[0:75] + dots
  ...                 print hsp.match[0:75] + dots
  ...                 print hsp.sbjct[0:75] + dots
>>
  
  The iterator allows you to deal with huge blast records without any
memory problems, since things are read in one at a time. I have parsed
tremendously huge files without any problems using this.
  

6.6.3  Finding a bad record somewhere in a huge file
====================================================
  
  One really ugly problem that happens to me is that I'll be parsing a
huge blast file for a while, and the parser will bomb out with a
ValueError. This is a serious problem, since you can't tell if the
ValueError is due to a parser problem, or a problem with the BLAST. To
make it even worse, you have no idea where the parse failed, so you
can't just ignore the error, since this could be ignoring an important
data point.
  We used to have to make a little script to get around this problem,
but the 'Bio.Blast' module now includes a 'BlastErrorParser' which
really helps make this easier. The 'BlastErrorParser' works very similar
to the regular 'BlastParser', but it adds an extra layer of work by
catching ValueErrors that are generated by the parser, and attempting to
diagnose the errors.
  Let's take a look at using this parser -- first we define the file we
are going to parse and the file to write the problem reports to:
<<>>> import os
  >>> blast_file = os.path.join(os.getcwd(), "blast_out",
"big_blast.out")
  >>> error_file = os.path.join(os.getcwd(), "blast_out",
"big_blast.problems")
>>
  
  Now we want to get a 'BlastErrorParser':
<<>>> from Bio.Blast import NCBIStandalone
  >>> error_handle = open(error_file, "w")
  >>> blast_error_parser = NCBIStandalone.BlastErrorParser(error_handle)
>>
  
  Notice that the parser take an optional argument of a handle. If a
handle is passed, then the parser will write any blast records which
generate a ValueError to this handle. Otherwise, these records will not
be recorded.
  Now we can use the 'BlastErrorParser' just like a regular blast
parser. Specifically, we might want to make an iterator that goes
through our blast records one at a time and parses them with the error
parser:
<<>>> result_handle = open(blast_file)
  >>> iterator = NCBIStandalone.Iterator(result_handle,
blast_error_parser)
>>
  
  We can read these records one a time, but now we can catch and deal
with errors that are due to problems with Blast (and not with the parser
itself):
<<>>> try:
  ...     next_record = iterator.next()
  ... except NCBIStandalone.LowQualityBlastError, info:
  ...     print "LowQualityBlastError detected in id %s" % info[1]
>>
  
  The '.next()' method is normally called indirectly via a 'for'-loop.
Right now the 'BlastErrorParser' can generate the following errors:
  
  
   - 'ValueError' -- This is the same error generated by the regular
   BlastParser, and is due to the parser not being able to parse a
   specific file. This is normally either due to a bug in the parser, or
   some kind of discrepancy between the version of BLAST you are using
   and the versions the parser is able to handle.
 
   - 'LowQualityBlastError' -- When BLASTing a sequence that is of
   really bad quality (for example, a short sequence that is basically a
   stretch of one nucleotide), it seems that Blast ends up masking out
   the entire sequence and ending up with nothing to parse. In this case
   it will produce a truncated report that causes the parser to generate
   a ValueError. 'LowQualityBlastError' is reported in these cases. This
   error returns an info item with the following information: 
     
      - 'item[0]' -- The error message 
      - 'item[1]' -- The id of the input record that caused the error.
      This is really useful if you want to record all of the records
      that are causing problems. 
  
  
  As mentioned, with each error generated, the BlastErrorParser will
write the offending record to the specified 'error_handle'. You can then
go ahead and look and these and deal with them as you see fit. Either
you will be able to debug the parser with a single blast report, or will
find out problems in your blast runs. Either way, it will definitely be
a useful experience!
  Hopefully the 'BlastErrorParser' will make it much easier to debug and
deal with large Blast files.
  

6.7  Dealing with PSIBlast
*=*=*=*=*=*=*=*=*=*=*=*=*=

  
  We should write some stuff to make it easier to deal directly with
PSIBlast from scripts (i. e. output the align file in the proper format
from an alignment). I need to look at PSIBlast more and come up with
some good ways of going this...
-----------------------------------
  
  
 (1) examples/m_cold.fasta
 
 (2) http://biopython.org/DIST/docs/tutorial/examples/m_cold.fasta
  

Chapter 7    Accessing NCBI's Entrez databases
**********************************************
   
  Entrez (http://www.ncbi.nlm.nih.gov/Entrez) is a data retrieval system
that provides users access to NCBI's databases such as PubMed, GenBank,
GEO, and many others. You can access Entrez from a web browser to
manually enter queries, or you can use Biopython's 'Bio.Entrez' module
for programmatic access to Entrez. The latter allows you for example to
search PubMed or download GenBank records from within a Python script.
  The 'Bio.Entrez' module makes use of the Entrez Programming Utilities,
consisting of eight tools that are described in detail on NCBI's page at
http://www.ncbi.nlm.nih.gov/entrez/utils/. Each of these tools
corresponds to one Python function in the 'Bio.Entrez' module, as
described in the sections below. This module makes sure that the correct
URL is used for the queries, and that not more than one request is made
every three seconds, as required by NCBI.
  The output returned by the Entrez Programming Utilities is typically
in XML format. To parse such output, you have several options: 
  
   1. Use 'Bio.Entrez''s parser to parse the XML output into a Python
   object; 
   2. Use the DOM (Document Object Model) parser in Python's standard
   library; 
   3. Use the SAX (Simple API for XML) parser in Python's standard
   library; 
   4. Read the XML output as raw text, and parse it by string searching
   and manipulation. 
   For the DOM and SAX parsers, see the Python documentation. The parser
in 'Bio.Entrez' is discussed below.
  For sequence databases, the Entrez Programming Utilities can also
generate output in other formats (such as the Fasta and GenBank file
format). This can then be parsed into a SeqRecord using 'Bio.SeqIO' (see
Chapter 4, and the example below).
  

7.1  Entrez Guidelines
*=*=*=*=*=*=*=*=*=*=*=

    Before using Biopython to access the NCBI's online resources (via
'Bio.Entrez' or some of the other modules), please read the NCBI's
Entrez User Requirements (1). If the NCBI finds you are abusing their
systems, they can and will ban your access! 
  To paraphrase:
  
  
   - For any series of more than 100 requests, do this at weekends or
   outside USA peak times. This is up to you to obey. 
   - Use the http://eutils.ncbi.nlm.nih.gov address, not the standard
   NCBI Web address. Biopython uses this web address. 
   - Make no more than one request every 3 seconds. This is
   automatically enforced by Biopython. 
   - Use the optional email parameter so the NCBI can contact you if
   there is a problem. In the examples below, we have used
   email="A.N.Other@example.com" for illustrative purposes. The
   example.com address is a reserved domain name specifically for
   documentation (RFC 2606). Please DO NOT use a random email -- it's
   better not to give an email at all. 
   - If you are using Biopython within some larger software suite, use
   the tool parameter to specify this. The tool parameter will default
   to Biopython. 
  
  For large queries, the NCBI also recommend using their session history
feature (the WebEnv session cookie string). This is only slightly more
complicated.
  In conclusion, be sensible with your usage levels. If you plan to
download lots of data, consider other options. For example, if you want
easy access to all the human genes, consider fetching each chromosome by
FTP as a GenBank file, and importing these into your own BioSQL database
(see Section 9.5).
  

7.2  EInfo: Obtaining information about the Entrez databases
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=

  
  EInfo provides field index term counts, last update, and available
links for each of NCBI's databases. In addition, you can use EInfo to
obtain a list of all database names accessible through the Entrez
utilities: 
<<>>> from Bio import Entrez
  >>> handle = Entrez.einfo(email="A.N.Other@example.com")
  >>> result = handle.read()
>>
  The variable 'result' now contains a list of databases in XML format: 
<<>>> print result
  <?xml version="1.0"?>
  <!DOCTYPE eInfoResult PUBLIC "-//NLM//DTD eInfoResult, 11 May
2002//EN"
   "http://www.ncbi.nlm.nih.gov/entrez/query/DTD/eInfo_020511.dtd">
  <eInfoResult>
  <DbList>
          <DbName>pubmed</DbName>
          <DbName>protein</DbName>
          <DbName>nucleotide</DbName>
          <DbName>nuccore</DbName>
          <DbName>nucgss</DbName>
          <DbName>nucest</DbName>
          <DbName>structure</DbName>
          <DbName>genome</DbName>
          <DbName>books</DbName>
          <DbName>cancerchromosomes</DbName>
          <DbName>cdd</DbName>
          <DbName>gap</DbName>
          <DbName>domains</DbName>
          <DbName>gene</DbName>
          <DbName>genomeprj</DbName>
          <DbName>gensat</DbName>
          <DbName>geo</DbName>
          <DbName>gds</DbName>
          <DbName>homologene</DbName>
          <DbName>journals</DbName>
          <DbName>mesh</DbName>
          <DbName>ncbisearch</DbName>
          <DbName>nlmcatalog</DbName>
          <DbName>omia</DbName>
          <DbName>omim</DbName>
          <DbName>pmc</DbName>
          <DbName>popset</DbName>
          <DbName>probe</DbName>
          <DbName>proteinclusters</DbName>
          <DbName>pcassay</DbName>
          <DbName>pccompound</DbName>
          <DbName>pcsubstance</DbName>
          <DbName>snp</DbName>
          <DbName>taxonomy</DbName>
          <DbName>toolkit</DbName>
          <DbName>unigene</DbName>
          <DbName>unists</DbName>
  </DbList>
  </eInfoResult>
>>
  
  Since this is a fairly simple XML file, we could extract the
information it contains simply by string searching. Using 'Bio.Entrez''s
parser instead, we can directly parse this XML file into a Python
object: 
<<>>> from Bio import Entrez
  >>> handle = Entrez.einfo(email="A.N.Other@example.com")
  >>> record = Entrez.read(handle)
>>
  Now 'record' is a dictionary with exactly one key: 
<<>>> record.keys()
  [u'DbList']
>>
  The values stored in this key is the list of database names shown in
the XML above: 
<<>>> record["DbList"]
  ['pubmed', 'protein', 'nucleotide', 'nuccore', 'nucgss', 'nucest',
   'structure', 'genome', 'books', 'cancerchromosomes', 'cdd', 'gap',
   'domains', 'gene', 'genomeprj', 'gensat', 'geo', 'gds', 'homologene',
   'journals', 'mesh', 'ncbisearch', 'nlmcatalog', 'omia', 'omim',
'pmc',
   'popset', 'probe', 'proteinclusters', 'pcassay', 'pccompound',
   'pcsubstance', 'snp', 'taxonomy', 'toolkit', 'unigene', 'unists']
>>
  
  For each of these databases, we can use EInfo again to obtain more
information: 
<<>>> handle = Entrez.einfo(db="pubmed", email="A.N.Other@example.com")
  >>> record = Entrez.read(handle)
  >>> record["DbInfo"]["Description"]
  'PubMed bibliographic record'
  >>> record["DbInfo"]["Count"]
  '17989604'
  >>> record["DbInfo"]["LastUpdate"]
  '2008/05/24 06:45'
>>
  Try 'record["DbInfo"].keys()' for other information stored in this
record.
  

7.3  ESearch: Searching the Entrez databases
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=

    To search any of these databases, we use 'Bio.Entrez.esearch()'. For
example, let's search in PubMed for publications related to Biopython: 
<<>>> from Bio import Entrez
  >>> handle = Entrez.esearch(db="pubmed", term="biopython",
email="A.N.Other@example.com")
  >>> record = Entrez.read(handle)
  >>> record["IdList"]
  ['16403221', '16377612', '14871861', '14630660', '12230038']
>>
  In this output, you see five PubMed IDs (16403221, 16377612, 14871861,
14630660, 12230038), which can be retrieved by EFetch (see section 7.6).
  You can also use ESearch to search GenBank. Here we'll do a quick
search for the rpl16 gene in Opuntia:
<<>>> handle = Entrez.esearch(db="nucleotide",term="Opuntia and rpl16",
                              email="A.N.Other@example.com")
  >>> record = Entrez.read(handle)
  >>> record["Count"]
  '9'
  >>> record["IdList"]
  ['57240072', '57240071', '6273287', '6273291', '6273290',
   '6273289', '6273286', '6273285', '6273284']
>>
  
  Each of the IDs (57240072, 57240071, 6273287...) is a GenBank
identifier. See section 7.6 for information on how to actually download
these GenBank records.
  As a final example, let's get a list of computational journal titles: 
<<>>> handle = Entrez.esearch(db="journals", term="computational",
                              email="A.N.Other@example.com")
  >>> record = Entrez.read(handle)
  >>> record["Count"]
  '16'
  >>> record["IdList"]
  ['30367', '33843', '33823', '32989', '33190', '33009', '31986',
   '34502', '8799', '22857', '32675', '20258', '33859', '32534',
   '32357', '32249']
>>
  Again, we could use EFetch to obtain more information for each of
these journal IDs.
  ESearch has many useful options --- see the ESearch help page (2) for
more information.
  

7.4  EPost
*=*=*=*=*=

   EPost posts a list of UIs for use in subsequent search strategies;
see the EPost help page (3) for more information. It is available from
Biopython through 'Bio.Entrez.epost()'.
  

7.5  ESummary: Retrieving summaries from primary IDs
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=

   ESummary retrieves document summaries from a list of primary IDs (see
the ESummary help page (4) for more information). In Biopython, ESummary
is available as 'Bio.Entrez.esummary()'. Using the search result above,
we can for example find out more about the journal with ID 30367: 
<<>>> from Bio import Entrez
  >>> handle = Entrez.esummary(db="journals", id="30367",
email="A.N.Other@example.com")
  >>> record = Entrez.read(handle)
  >>> record[0]["Id"]
  '30367'
  >>> record[0]["Title"]
  'Computational biology and chemistry'
  >>> record[0]["Publisher"]
  'Pergamon,'
>>
  
  

7.6  EFetch: Downloading full records from Entrez
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*

   
  EFetch is what you use when you want to retrieve a full record from
Entrez. For the Opuntia example above, we can download GenBank record
57240072 using 'Bio.Entrez.efetch':
<<>>> handle = Entrez.efetch(db="nucleotide", id="57240072",
rettype="genbank", 
                             email="A.N.Other@example.com")
  >>> print handle.read()
  LOCUS       AY851612                 892 bp    DNA     linear   PLN
10-APR-2007
  DEFINITION  Opuntia subulata rpl16 gene, intron; chloroplast.
  ACCESSION   AY851612
  VERSION     AY851612.1  GI:57240072
  KEYWORDS    .
  SOURCE      chloroplast Austrocylindropuntia subulata
    ORGANISM  Austrocylindropuntia subulata
              Eukaryota; Viridiplantae; Streptophyta; Embryophyta;
Tracheophyta;
              Spermatophyta; Magnoliophyta; eudicotyledons; core
eudicotyledons;
              Caryophyllales; Cactaceae; Opuntioideae;
Austrocylindropuntia.
  REFERENCE   1  (bases 1 to 892)
    AUTHORS   Butterworth,C.A. and Wallace,R.S.
    TITLE     Molecular Phylogenetics of the Leafy Cactus Genus Pereskia
              (Cactaceae)
    JOURNAL   Syst. Bot. 30 (4), 800-808 (2005)
  REFERENCE   2  (bases 1 to 892)
    AUTHORS   Butterworth,C.A. and Wallace,R.S.
    TITLE     Direct Submission
    JOURNAL   Submitted (10-DEC-2004) Desert Botanical Garden, 1201
North Galvin
              Parkway, Phoenix, AZ 85008, USA
  FEATURES             Location/Qualifiers
       source          1..892
                       /organism="Austrocylindropuntia subulata"
                       /organelle="plastid:chloroplast"
                       /mol_type="genomic DNA"
                       /db_xref="taxon:106982"
       gene            <1..>892
                       /gene="rpl16"
       intron          <1..>892
                       /gene="rpl16"
  ORIGIN      
          1 cattaaagaa gggggatgcg gataaatgga aaggcgaaag aaagaaaaaa
atgaatctaa
         61 atgatatacg attccactat gtaaggtctt tgaatcatat cataaaagac
aatgtaataa
        121 agcatgaata cagattcaca cataattatc tgatatgaat ctattcatag
aaaaaagaaa
        181 aaagtaagag cctccggcca ataaagacta agagggttgg ctcaagaaca
aagttcatta
        241 agagctccat tgtagaattc agacctaatc attaatcaag aagcgatggg
aacgatgtaa
        301 tccatgaata cagaagattc aattgaaaaa gatcctaatg atcattggga
aggatggcgg
        361 aacgaaccag agaccaattc atctattctg aaaagtgata aactaatcct
ataaaactaa
        421 aatagatatt gaaagagtaa atattcgccc gcgaaaattc cttttttatt
aaattgctca
        481 tattttattt tagcaatgca atctaataaa atatatctat acaaaaaaat
atagacaaac
        541 tatatatata taatatattt caaatttcct tatataccca aatataaaaa
tatctaataa
        601 attagatgaa tatcaaagaa tctattgatt tagtgtatta ttaaatgtat
atcttaattc
        661 aatattatta ttctattcat ttttattcat tttcaaattt ataatatatt
aatctatata
        721 ttaatttata attctattct aattcgaatt caatttttaa atattcatat
tcaattaaaa
        781 ttgaaatttt ttcattcgcg aggagccgga tgagaagaaa ctctcatgtc
cggttctgta
        841 gtagagatgg aattaagaaa aaaccatcaa ctataacccc aagagaacca ga
  //
>>
  
  The argument 'rettype="genbank"' lets us download this record in the
GenBank format. Alternatively, you could for example use
'rettype="fasta"' to get the Fasta-format; see the EFetch Help page (5)
for other options. The available formats depend on which database you
are downloading from.
  If you fetch the record in one of the formats accepted by 'Bio.SeqIO'
(see Chapter 4), you can directly parse it into a 'SeqRecord':
<<>>> from Bio import Entrez, SeqIO
  >>> handle = Entrez.efetch(db="nucleotide",
id="57240072",rettype="genbank",
                             email="A.N.Other@example.com")
  >>> record = SeqIO.read(handle, "genbank")
  >>> print record
  ID: AY851612.1
  Name: AY851612
  Desription: Opuntia subulata rpl16 gene, intron; chloroplast.
  /sequence_version=1
  /source=chloroplast Austrocylindropuntia subulata
  ....
>>
  
  By default you get the output in XML format, which you can parse using
the 'Bio.Entrez.read()' function:
<<>>> from Bio import Entrez
  >>> handle = Entrez.efetch(db="nucleotide", id="57240072",
                             email="A.N.Other@example.com")
  >>> record = Entrez.read(handle)
  >>> record[0]["GBSeq_definition"]
  'Opuntia subulata rpl16 gene, intron; chloroplast'
  >>> record[0]["GBSeq_source"]
  'chloroplast Austrocylindropuntia subulata'
  ....
>>
  
  

7.7  ELink
*=*=*=*=*=

   For help on ELink, see the ELink help page (6). ELink is available
from Biopython through 'Bio.Entrez.elink()'.
  

7.8  EGQuery: Obtaining counts for search terms
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*

   EGQuery provides counts for a search term in each of the Entrez
databases. This is particularly useful to find out how many items a
search will return before actually performing the search with ESearch
(see the example in 7.10.1 below).
  In this example, we use 'Bio.Entrez.egquery()' to obtain the counts
for "Biopython":
<<>>> handle = Entrez.egquery(term="biopython",
                              email="A.N.Other@example.com") 
  >>> record = Entrez.read(handle)
  >>> record["eGQueryResult"][0]["DbName"]
  'pubmed'
  >>> record["eGQueryResult"][0]["Count"]
  '5'
>>
  
  See the EGQuery help page (7) for more information.
  

7.9  ESpell: Obtaining spelling suggestions
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*

   ESpell retrieves spelling suggestions. In this example, we use
'Bio.Entrez.espell()' to obtain the correct spelling of Biopython:
<<>>> from Bio import Entrez
  >>> handle = Entrez.espell(term="biopythooon",
email="A.N.Other@example.com")
  >>> record = Entrez.read(handle)
  >>> record["Query"]
  'biopythooon'
  >>> record["CorrectedQuery"]
  'biopython'
>>
  See the ESpell help page (8) for more information.
  

7.10  Examples
*=*=*=*=*=*=*=

   
  

7.10.1  Searching and downloading Entrez Nucleotide records
===========================================================
   
  Here we'll show a simple example of performing a remote Entrez query.
In section 2.3 of the parsing examples, we talked about using NCBI's
Entrez website to search the NCBI nucleotide databases for info on
Cypripedioideae, our friends the lady slipper orchids. Now, we'll look
at how to automate that process using a Python script. In this example,
we'll just show how to connect, get the results, and parse them, with
the Entrez module doing all of the work.
  First, we use EGQuery to find out the number of results we will get
before actually downloading them: 
<<>>> from Bio import Entrez
  >>> handle = Entrez.egquery(term='Cypripedioideae',
email="A.N.Other@example.com")
  >>> record = Entrez.read(handle)
  >>> for row in record['eGQueryResult']:
  ...     if row['DbName']=='nuccore':
  ...         print row['Count']
  814
>>
  
  So, we expect to find 814 Entrez Nucleotide records. If you find some
ridiculously high number of hits, you may want to reconsider if you
really want to download all of them, which is our next step: 
<<>>> from Bio import Entrez
  >>> handle = Entrez.esearch(db='nucleotide', term='Cypripedioideae',
retmax=814,
                              email="A.N.Other@example.com")
  >>> record = Entrez.read(handle)
>>
  
  Here, 'record' is a Python dictionary containing the search results
and some auxiliary information. Just for information, let's look at what
is stored in this dictionary: 
<<>>> print record.keys()
  [u'Count', u'RetMax', u'IdList', u'TranslationSet', u'RetStart',
u'QueryTranslation']
>>
  First, let's check how many results were found: 
<<>>> print record['Count']
  '814'
>>
  which is the number we expected. The 814 results are stored in
'record['IdList']': 
<<>>> print len(record['IdList'])
  814
>>
  Let's look at the first five results: 
<<>>> print record['IdList'][:5]
  ['187237168', '187372713', '187372690', '187372688', '187372686']
>>
  
   We can download these records using 'efetch'. While you could
download these records one by one, to reduce the load on NCBI's servers,
it is better to fetch a bunch of records at the same time, shown below.
However, in this situation you should ideally be using the history
feature described later in Section 7.10.3.
<<>>> idlist = ",".join(record['IdList'][:5])
  >>> print idlist
  187237168,187372713,187372690,187372688,187372686
  >>> handle = Entrez.efetch(db='nucleotide', id=idlist, retmode='xml',
                             email="A.N.Other@example.com")
  >>> records = Entrez.read(handle)
  >>> print len(records)
  5
>>
  Each of these records corresponds to one GenBank record. 
<<>>> print records[0].keys()
  [u'GBSeq_moltype', u'GBSeq_source', u'GBSeq_sequence',
   u'GBSeq_primary-accession', u'GBSeq_definition',
u'GBSeq_accession-version',
   u'GBSeq_topology', u'GBSeq_length', u'GBSeq_feature-table',
   u'GBSeq_create-date', u'GBSeq_other-seqids', u'GBSeq_division',
   u'GBSeq_taxonomy', u'GBSeq_references', u'GBSeq_update-date',
   u'GBSeq_organism', u'GBSeq_locus', u'GBSeq_strandedness']
  
  >>> print records[0]['GBSeq_primary-accession']
  DQ110336
  
  >>> print records[0]['GBSeq_other-seqids']
  ['gb|DQ110336.1|', 'gi|187237168']
  
  >>> print records[0]['GBSeq_definition']
  Cypripedium calceolus voucher Davis 03-03 A maturase (matR) gene,
partial cds;
  mitochondrial
  
  >>> print records[0]['GBSeq_organism']
  Cypripedium calceolus
>>
  
  You could use this to quickly set up searches -- but for heavy usage,
see Section 7.10.3.
  

7.10.2  Finding the lineage of an organism
==========================================
  
  Staying with the same organism, let's now find its lineage. First, we
search the Taxonomy database for Cypripedioideae. We find exactly one
accession number: 
<<>>> handle = Entrez.esearch(db="Taxonomy", term="Cypripedioideae",
                              email="A.N.Other@example.com")
  >>> record = Entrez.read(handle)
  >>> record["IdList"]
  ['158330']
  >>> record["IdList"][0]
  '158330'
>>
  Now, we use 'efetch' to download this entry in the Taxonomy database
and to parse it: 
<<>>> handle = Entrez.efetch(db="Taxonomy", id="158330", retmode='xml')
  >>> records = Entrez.read(handle)
>>
  Again, this record stores lots of information: 
<<>>> records[0].keys()
  [u'Lineage', u'Division', u'ParentTaxId', u'PubDate', u'LineageEx',
   u'CreateDate', u'TaxId', u'Rank', u'GeneticCode', u'ScientificName',
   u'MitoGeneticCode', u'UpdateDate']
>>
  We can get the lineage directly from this record: 
<<>>> records[0]['Lineage']
  'cellular organisms; Eukaryota; Viridiplantae; Streptophyta;
Streptophytina;
   Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta;
Magnoliophyta;
   Liliopsida; Asparagales; Orchidaceae'
>>
  
  

7.10.3  Using the history and WebEnv
====================================
   
  Often you will want to make a series of linked queries. Most
typically, running a search, perhaps refining the search, and then
retrieving detailed search results. You can do this by making a series
of separate calls to Entrez. However, the NCBI prefer you to take
advantage of their history support.
  For example, suppose we want to search and download all Orchid rpl16
nucleotide sequences, and store them in a FASTA file. We could naively
combine the example code for 'Bio.Entrez.esearch()' (Section 7.3) to get
a list of GI numbers, and then repeatedly call 'Bio.Entrez.efetch()'
(Section 7.6) to download them all. You could reduce the number of
queries by asking for the records in batches (see Section 7.10.1). That
would probably be better, but is still not what the NCBI encourage.
  The approved approach is to run the search with the history feature.
Then, we can fetch the results by reference to the search results -
which the NCBI can anticipate and cache.
<<from Bio import Entrez
  search_handle = Entrez.esearch(db="nucleotide",term="Opuntia and
rpl16",
                                 usehistory="y",
email="history.user@example.com")
  search_results = Entrez.read(search_handle)
  search_handle.close()
  
  gi_list = search_results["IdList"]
  count = int(search_results["Count"])
  assert count == len(gi_list)
  
  session_cookie = search_results["WebEnv"]
  query_key = search_results["QueryKey"] 
>>
  
  In addition to the GI numbers of the sequences found in the search,
because we have asked to use the history feature the XML search results
also include WebEnv and QueryKey values which are used to refer to these
search results. Having stored these values in variables session_cookie
and query_key we can use them as parameters to 'Bio.Entrez.efetch()'
instead of giving the GI numbers as identifiers. 
  While for small searches you might be OK downloading everything at
once, its better download in batches. You use the retstart and retmax
parameters to specify which range of search results you want returned
(starting entry using zero-based counting, and maximum number of results
to return). For example,
<<batch_size = 3
  out_handle = open("orchid_rpl16.fasta", "w")
  for start in range(0,count,batch_size) :
      end = min(count, start+batch_size)
      print "Going to download record %i to %i" % (start+1, end)
      fetch_handle = Entrez.efetch(db="nucleotide", rettype="fasta",
                                   retstart=start, retmax=batch_size,
                                   webenv=session_cookie,
query_key=query_key,
                                   email="history.user@example.com")
      data = fetch_handle.read()
      fetch_handle.close()
      out_handle.write(data)
  out_handle.close()
>>
  
  And finally, don't forget to include your own email address in the
Entrez calls.
-----------------------------------
  
  
 (1) http://www.ncbi.nlm.nih.gov/entrez/query/static/eutils_help.html#Us
   erSystemRequirements
 
 (2) http://www.ncbi.nlm.nih.gov/entrez/query/static/esearch_help.html
 
 (3) http://www.ncbi.nlm.nih.gov/entrez/query/static/epost_help.html
 
 (4) http://www.ncbi.nlm.nih.gov/entrez/query/static/esummary_help.html
 
 (5) http://www.ncbi.nlm.nih.gov/entrez/query/static/efetchseq_help.html
 
 (6) http://www.ncbi.nlm.nih.gov/entrez/query/static/elink_help.html
 
 (7) http://www.ncbi.nlm.nih.gov/entrez/query/static/egquery_help.html
 
 (8) http://www.ncbi.nlm.nih.gov/entrez/query/static/espell_help.html
  

Chapter 8    Swiss-Prot, Prosite, Prodoc, and ExPASy
****************************************************
   
  

8.1  Bio.SwissProt: Parsing Swiss-Prot files
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=

  
  

8.1.1  Parsing Swiss-Prot records
=================================
  
  Swiss-Prot (http://www.expasy.org/sprot) is a hand-curated database of
protein sequences. In Section 4.2.2, we described how to extract the
sequence of a Swiss-Prot record as a 'SeqRecord' object. Alternatively,
you can store the Swiss-Prot record in a 'Bio.SwissProt.SProt.Record'
object, which in fact stores the complete information contained in the
Swiss-Prot record. In this Section, we describe how to extract
'Bio.SwissProt.SProt.Record' objects from a Swiss-Prot file.
  To parse a Swiss-Prot record, we first get a handle to a Swiss-Prot
record. There are several ways to do so, depending on where and how the
Swiss-Prot record is stored: 
  
   - Open a Swiss-Prot file locally:
 '>>> handle = open("myswissprotfile.dat")' 
   - Open a gzipped Swiss-Prot file: 
   <<>>> import gzip
     >>> handle = gzip.open("myswissprotfile.dat.gz")
   >>
 
   - Open a Swiss-Prot file over the internet: 
   <<>>> import urllib
     >>> handle =
   urllib.urlopen("http://www.somelocation.org/data/someswissprotfile.da
   t")
   >>
 
   - Open a Swiss-Prot file over the internet from the ExPASy database
   (see section 8.4.1): 
   <<>>> from Bio import ExPASy
     >>> handle = ExPASy.get_sprot_raw(myaccessionnumber)
   >>
   The key point is that for the parser, it doesn't matter how the
handle was created, as long as it points to data in the Swiss-Prot
format.
  We can use Bio.SeqIO as described in Section 4.2.2 to get file format
agnostic 'SeqRecord' objects. Alternatively, we can get
'Bio.SwissProt.SProt.Record' objects which are a much closer match to
the underlying file format, using following code.
  To read one Swiss-Prot record from the handle, we use the function
'read()': 
<<>>> from Bio import SwissProt
  >>> record = SwissProt.read(handle)
>>
  This function should be used if the handle points to exactly one
Swiss-Prot record. It raises a 'ValueError' if no Swiss-Prot record was
found, and also if more than one record was found.
  We can now print out some information about this record: 
<<>>> print record.description
  CHALCONE SYNTHASE 3 (EC 2.3.1.74) (NARINGENIN-CHALCONE SYNTHASE 3).
  >>> for ref in record.references:
  ...     print "authors:", ref.authors
  ...     print "title:", ref.title
  ...
  authors: Liew C.F., Lim S.H., Loh C.S., Goh C.J.;
  title: "Molecular cloning and sequence analysis of chalcone synthase
cDNAs of
  Bromheadia finlaysoniana.";
  >>> print record.organism_classification
  ['Eukaryota', 'Viridiplantae', 'Embryophyta', 'Tracheophyta',
'Spermatophyta',
  'Magnoliophyta', 'Liliopsida', 'Asparagales', 'Orchidaceae',
'Bromheadia']
>>
  
  To parse a file that contains more than one Swiss-Prot record, we use
the 'parse' function instead. This function allows us to iterate over
the records in the file. For example, let's parse the full Swiss-Prot
database and collect all the descriptions. The full Swiss-Prot database,
downloaded from ExPASy on 4 December 2007, contains 290484 Swiss-Prot
records in a single gzipped-file 'uniprot_sprot.dat.gz'.
<<>>> import gzip
  >>> input = gzip.open("uniprot_sprot.dat.gz")
  >>> from Bio import SwissProt
  >>> records = SwissProt.parse(input)
  >>> descriptions = []
  >>> for record in records:
  ...     description = record.description
  ...     descriptions.append(description)
  ...
  >>> len(descriptions)
  290484
  >>> descriptions[:3]
  ['104 kDa microneme/rhoptry antigen precursor (p104).',
   '104 kDa microneme/rhoptry antigen precursor (p104).',
   'Protein 108 precursor.']
>>
  
  It is equally easy to extract any kind of information you'd like from
Swiss-Prot records. To see the members of a Swiss-Prot record, use 
<<>>> dir(record)
  ['__doc__', '__init__', '__module__', 'accessions',
'annotation_update',
  'comments', 'created', 'cross_references', 'data_class',
'description',
  'entry_name', 'features', 'gene_name', 'host_organism', 'keywords',
  'molecule_type', 'organelle', 'organism', 'organism_classification',
  'references', 'seqinfo', 'sequence', 'sequence_length',
  'sequence_update', 'taxonomy_id']
>>
  
  

8.1.2  Parsing the Swiss-Prot keyword and category list
=======================================================
  
  Swiss-Prot also distributes a file 'keywlist.txt', which lists the
keywords and categories used in Swiss-Prot. The file contains entries in
the following form:
<<ID   2Fe-2S.
  AC   KW-0001
  DE   Protein which contains at least one 2Fe-2S iron-sulfur cluster: 2
iron
  DE   atoms complexed to 2 inorganic sulfides and 4 sulfur atoms of
  DE   cysteines from the protein.
  SY   Fe2S2; [2Fe-2S] cluster; [Fe2S2] cluster; Fe2/S2 (inorganic)
cluster;
  SY   Di-mu-sulfido-diiron; 2 iron, 2 sulfur cluster binding.
  GO   GO:0051537; 2 iron, 2 sulfur cluster binding
  HI   Ligand: Iron; Iron-sulfur; 2Fe-2S.
  HI   Ligand: Metal-binding; 2Fe-2S.
  CA   Ligand.
  //
  ID   3D-structure.
  AC   KW-0002
  DE   Protein, or part of a protein, whose three-dimensional structure
has
  DE   been resolved experimentally (for example by X-ray
crystallography or
  DE   NMR spectroscopy) and whose coordinates are available in the PDB
  DE   database. Can also be used for theoretical models.
  HI   Technical term: 3D-structure.
  CA   Technical term.
  //
  ID   3Fe-4S.
  ...
>>
  
  The entries in this file can be parsed by the 'parse' function in the
'Bio.SwissProt.KeyWList' module. Each entry is then stored as a
'Bio.SwissProt.KeyWList.Record', which is a Python dictionary.
<<>>> from Bio.SwissProt import KeyWList
  >>> handle = open("keywlist.txt")
  >>> records = KeyWList.parse(handle)
  >>> for record in records:
  ...     print record['ID']
  ...     print record['DE']
>>
  
  This prints 
<<2Fe-2S.
  Protein which contains at least one 2Fe-2S iron-sulfur cluster: 2 iron
atoms
  complexed to 2 inorganic sulfides and 4 sulfur atoms of cysteines from
the
  protein.
  ...
>>
  
  

8.2  Bio.Prosite: Parsing Prosite records
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*

  
  Prosite is a database containing protein domains, protein families,
functional sites, as well as the patterns and profiles to recognize
them. Prosite was developed in parallel with Swiss-Prot. In Biopython, a
Prosite record is represented by the 'Bio.Prosite.Record' class, whose
members correspond to the different fields in a Prosite record.
  In general, a Prosite file can contain more than one Prosite records.
For example, the full set of Prosite records, which can be downloaded as
a single file ('prosite.dat') from ExPASy, contains 2073 records in
(version 20.24 released on 4 December 2007). To parse such a file, we
again make use of an iterator:
<<>>> from Bio import Prosite
  >>> handle = open("myprositefile.dat")
  >>> records = Prosite.parse(handle)
>>
  
  We can now take the records one at a time and print out some
information. For example, using the file containing the complete Prosite
database, we'd find 
<<>>> from Bio import Prosite
  >>> handle = open("prosite.dat")
  >>> records = Prosite.parse(handle)
  >>> record = records.next()
  >>> record.accession
  'PS00001'
  >>> record.name
  'ASN_GLYCOSYLATION'
  >>> record.pdoc
  'PDOC00001'
  >>> record = records.next()
  >>> record.accession
  'PS00004'
  >>> record.name
  'CAMP_PHOSPHO_SITE'
  >>> record.pdoc
  'PDOC00004'
  >>> record = records.next()
  >>> record.accession
  'PS00005'
  >>> record.name
  'PKC_PHOSPHO_SITE'
  >>> record.pdoc
  'PDOC00005'
>>
  and so on. If you're interested in how many Prosite records there are,
you could use 
<<>>> from Bio import Prosite
  >>> handle = open("prosite.dat")
  >>> records = Prosite.parse(handle)
  >>> n = 0
  >>> for record in records: n+=1
  ...
  >>> print n
  2073
>>
  
  To read exactly one Prosite from the handle, you can use the 'read'
function: 
<<>>> from Bio import Prosite
  >>> handle = open("mysingleprositerecord.dat")
  >>> record = Prosite.read(handle)
>>
  This function raises a ValueError if no Prosite record is found, and
also if more than one Prosite record is found.
  

8.3  Bio.Prosite.Prodoc: Parsing Prodoc records
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*

  
  In the Prosite example above, the 'record.pdoc' accession numbers
''PDOC00001'', ''PDOC00004'', ''PDOC00005'' and so on refer to Prodoc
records, which contain the Prosite Documentation. The Prodoc records are
available from ExPASy as individual files, and as one file
('prosite.doc') containing all Prodoc records.
  We use the parser in 'Bio.Prosite.Prodoc' to parse Prodoc records. For
example, to create a list of all Prodoc accession numbers, you can use
<<>>> from Bio.Prosite import Prodoc
  >>> handle = open("prosite.doc")
  >>> records = Prodoc.parse(handle)
  >>> accessions = [record.accession for record in records]
>>
  
  Again a 'read()' function is provided to read exactly one Prodoc
record from the handle.
  

8.4  Bio.ExPASy: Accessing the ExPASy server
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=

  
  Swiss-Prot, Prosite, and Prodoc records can be downloaded from the
ExPASy web server at http://www.expasy.org. Six kinds of queries are
available from ExPASy: 
  
 get_prodoc_entry To download a Prodoc record in HTML format 
 get_prosite_entry To download a Prosite record in HTML format 
 get_prosite_raw To download a Prosite or Prodoc record in raw format 
 get_sprot_raw To download a Swiss-Prot record in raw format 
 sprot_search_ful To search for a Swiss-Prot record 
 sprot_search_de To search for a Swiss-Prot record 
   To access this web server from a Python script, we use the
'Bio.ExPASy' module.
  

8.4.1  Retrieving a Swiss-Prot record
=====================================
   
  Let's say we are looking at chalcone synthases for Orchids (see
section 2.3 for some justification for looking for interesting things
about orchids). Chalcone synthase is involved in flavanoid biosynthesis
in plants, and flavanoids make lots of cool things like pigment colors
and UV protectants. 
  If you do a search on Swiss-Prot, you can find three orchid proteins
for Chalcone Synthase, id numbers O23729, O23730, O23731. Now, let's
write a script which grabs these, and parses out some interesting
information.
  First, we grab the records, using the 'get_sprot_raw()' function of
'Bio.ExPASy'. This function is very nice since you can feed it an id and
get back a handle to a raw text record (no html to mess with!). We can
the use 'Bio.SwissProt.read' to pull out the Swiss-Prot record, or
'Bio.SeqIO.read' to get a SeqRecord. The following code accomplishes
what I just wrote:
<<>>> from Bio import ExPASy
  >>> from Bio import SwissProt
  
  >>> accessions = ["O23729", "O23730", "O23731"]
  >>> records = []
  
  >>> for accession in accessions:
  ...     handle = ExPASy.get_sprot_raw(accession)
  ...     record = SwissProt.read(handle)
  ...     records.append(record)
>>
  
  If the accession number you provided to 'ExPASy.get_sprot_raw' does
not exist, then 'SwissProt.read(handle)' will raise a 'ValueError'. You
can catch 'ValueException' exceptions to detect invalid accession
numbers:
<<>>> for accession in accessions:
  ...     handle = ExPASy.get_sprot_raw(accession)
  ...     try:
  ...         record = SwissProt.read(handle)
  ...     except ValueException:
  ...         print "WARNING: Accession %s not found" % accession
  ...     records.append(record)
>>
  
  

8.4.2  Searching Swiss-Prot
===========================
  
  Now, you may remark that I knew the records' accession numbers
beforehand. Indeed, 'get_sprot_raw()' needs either the entry name or an
accession number. When you don't have them handy, you can use one of the
'sprot_search_de()' or 'sprot_search_ful()' functions.
  'sprot_search_de()' searches in the ID, DE, GN, OS and OG lines;
'sprot_search_ful()' searches in (nearly) all the fields. They are
detailed on http://www.expasy.org/cgi-bin/sprot-search-de and
http://www.expasy.org/cgi-bin/sprot-search-ful respectively. Note that
they don't search in TrEMBL by default (argument 'trembl'). Note also
that they return html pages; however, accession numbers are quite easily
extractable:
<<>>> from Bio import ExPASy
  >>> import re
  
  >>> handle = ExPASy.sprot_search_de("Orchid Chalcone Synthase")
  >>> # or:
  >>> # handle = ExPASy.sprot_search_ful("Orchid and {Chalcone
Synthase}")
  >>> html_results = handle.read()
  >>> if "Number of sequences found" in html_results:
  ...     ids = re.findall(r'HREF="/uniprot/(\w+)"', html_results)
  ... else:
  ...     ids = re.findall(r'href="/cgi-bin/niceprot\.pl\?(\w+)"',
html_results)
>>
  
  

8.4.3  Retrieving Prosite and Prodoc records
============================================
  
  Prosite and Prodoc records can be retrieved either in HTML format, or
in raw format. To parse Prosite and Prodoc records with Biopython, you
should retrieve the records in raw format. For other purposes, however,
you may be interested in these records in HTML format.
  To retrieve a Prosite or Prodoc record in raw format, use
'get_prosite_raw()'. Although this function has 'prosite' in the name,
it can be used for Prodoc records as well. For example, to download a
Prosite record and print it out in raw text format, use
<<>>> from Bio import ExPASy
  >>> handle = ExPASy.get_prosite_raw('PS00001')
  >>> text = handle.read()
  >>> print text
>>
  
  To retrieve a Prosite record and parse it into a 'Bio.Prosite.Record'
object, use
<<>>> from Bio import ExPASy
  >>> from Bio import Prosite
  >>> handle = ExPASy.get_prosite_raw('PS00001')
  >>> record = Prosite.read(handle)
>>
  
  Finally, to retrieve a Prodoc record and parse it into a
'Bio.Prosite.Prodoc.Record' object, use
<<>>> from Bio import ExPASy
  >>> from Bio.Prosite import Prodoc
  >>> handle = ExPASy.get_prosite_raw('PDOC00001')
  >>> record = Prodoc.read(handle)
>>
  
  For non-existing accession numbers, 'ExPASy.get_prosite_raw' returns a
handle to an emptry string. When faced with an empty string,
'Prosite.read' and 'Prodoc.read' will raise a ValueError. You can catch
these exceptions to detect invalid accession numbers.
  The functions 'get_prosite_entry()' and 'get_prodoc_entry()' are used
to download Prosite and Prodoc records in HTML format. To create a web
page showing one Prosite record, you can use
<<>>> from Bio import ExPASy
  >>> handle = ExPASy.get_prosite_entry('PS00001')
  >>> html = handle.read()
  >>> output = open("myprositerecord.html", "w")
  >>> output.write(html)
  >>> output.close()
>>
  
  and similarly for a Prodoc record:
<<>>> from Bio import ExPASy
  >>> handle = ExPASy.get_prodoc_entry('PDOC00001')
  >>> html = handle.read()
  >>> output = open("myprodocrecord.html", "w")
  >>> output.write(html)
  >>> output.close()
>>
  
  For these functions, an invalid accession number returns an error
message in HTML format.
  

Chapter 9    Cookbook -- Cool things to do with it
**************************************************
   
  

9.1  PubMed
*=*=*=*=*=*

   
  The 'Bio.PubMed' module uses 'Bio.Entrez' internally to access the
NCBI. Please remember to read and observe the NCBI's guidelines on using
their Entrez online facilities responsibly. If you are found to be
abusing their servers, they can and will block your access! See
Section 7.1.
  

9.1.1  Sending a query to PubMed
================================
  
  If you are in the Medical field or interested in human issues (and
many times even if you are not!), PubMed
(http://www.ncbi.nlm.nih.gov/PubMed/) is an excellent source of all
kinds of goodies. So like other things, we'd like to be able to grab
information from it and use it in python scripts.
  Querying PubMed using Biopython is extremely painless. To get all of
the article ids for articles having to do with orchids (see section 2.3
for our motivation), we only need the following three lines of code:
<<from Bio import PubMed
  
  search_term = 'orchid'
  orchid_ids = PubMed.search_for(search_term)
>>
  
  This returns a python list containing all of the orchid ids
<<['11070358', '11064040', '11028023', '10947239', '10938351',
'10936520',
  '10905611', '10899814', '10856762', '10854740', '10758893',
'10716342',
  ...
>>
  
  With this list of ids we are ready to start retrieving the records, so
follow on ahead to the next section.
  

9.1.2  Retrieving a PubMed record
=================================
  
  The previous section described how to get a bunch of article ids. Now
that we've got them, we obviously want to get the corresponding Medline
records and extract the information from them.
  The interface for retrieving records from PubMed should be very
intuitive to python programmers -- it models a python dictionary. To set
up this interface, we need to set up a parser that will parse the
results that we retrieve. The following lines of code get everything set
up:
<<from Bio import PubMed
  from Bio import Medline
  
  rec_parser = Medline.RecordParser()
  medline_dict = PubMed.Dictionary(parser = rec_parser)
>>
  
  What we've done is create a dictionary like object 'medline_dict'. To
get an article we access it like 'medline_dict[id_to_get]'. What this
does is connect with PubMed, get the article you ask for, parse it into
a record object, and return it. Very cool!
  Now let's look at how to use this nice dictionary to print out some
information about some ids. We just need to loop through our ids
('orchid_ids' from the previous section) and print out the information
we are interested in:
<<for oid in orchid_ids[0:5]:
      cur_record = medline_dict[oid]
      print 'title:', cur_record.title.rstrip()
      print 'authors:', cur_record.authors
      print 'source:', cur_record.source.strip()
      print
>>
  
  The output for this looks like:
<<title: Sex pheromone mimicry in the early spider orchid (ophrys
sphegodes):
  patterns of hydrocarbons as the key mechanism for pollination by
sexual
  deception [In Process Citation]
  authors: ['Schiestl FP', 'Ayasse M', 'Paulus HF', 'Lofstedt C',
'Hansson BS',
  'Ibarra F', 'Francke W']
  source: J Comp Physiol [A] 2000 Jun;186(6):567-74
>>
  
  Especially interesting to note is the list of authors, which is
returned as a standard python list. This makes it easy to manipulate and
search using standard python tools. For instance, we could loop through
a whole bunch of entries searching for a particular author with code
like the following:
<<search_author = 'Waits T'
  
  for our_id in our_id_list:
      cur_record = medline_dict[our_id]
     
      if search_author in cur_record.authors:
          print "Author %s found: %s" % (search_author,
                                         cur_record.source.strip())
>>
  
  The PubMed and Medline interfaces are very mature and nice to work
with -- hopefully this section gave you an idea of the power of the
interfaces and how they can be used.
  

9.2  GenBank
*=*=*=*=*=*=

  
  The GenBank record format is a very popular method of holding
information about sequences, sequence features, and other associated
sequence information. The format is a good way to get information from
the NCBI databases at http://www.ncbi.nlm.nih.gov/.
  The 'Bio.GenBank' module uses the NCBI's Entrez interface to run
searches and fetch data. Please remember to read and observe the NCBI's
guidelines on using their Entrez online facilities responsibly. If you
are found to be abusing their servers, they can and will block your
access! See Section 7.1.
  

9.2.1  Retrieving GenBank entries from NCBI
===========================================
   
  One very nice feature of the GenBank libraries is the ability to
automate retrieval of entries from GenBank. This is very convenient for
creating scripts that automate a lot of your daily work. In this example
we'll show how to query the NCBI databases, and to retrieve the records
from the query - something touched on in Section 4.2.1.
  First, we want to make a query and find out the ids of the records to
retrieve. Here we'll do a quick search for our favorite organism,
Opuntia. We can do quick search and get back the GIs (GenBank
identifiers) for all of the corresponding records:
<<from Bio import GenBank
  
  gi_list = GenBank.search_for("Opuntia AND rpl16")
>>
  
  'gi_list' will be a list of all of the GenBank identifiers that match
our query:
<<["6273291", "6273290", "6273289", "6273287", "6273286", "6273285",
"6273284"]
>>
  
  Now that we've got the GIs, we can use these to access the NCBI
database through a dictionary interface. For instance, to retrieve the
information for the first GI, we'll first have to create a dictionary
that accesses NCBI:
<<ncbi_dict = GenBank.NCBIDictionary("nucleotide", "genbank")
>>
  
  Now that we've got this, we do the retrieval:
<<gb_record = ncbi_dict[gi_list[0]]
>>
  
  In this case, 'gb_record' will be GenBank formatted record:
<<LOCUS       AF191665      902 bp    DNA             PLN      
07-NOV-1999
  DEFINITION  Opuntia marenae rpl16 gene; chloroplast gene for
chloroplast
              product, partial intron sequence.
  ACCESSION   AF191665
  VERSION     AF191665.1  GI:6273291
  ...
>>
  
  In this case, we are just getting the raw records. We can also pass
these records directly into a parser and return the parsed record. For
instance, if we wanted to get back SeqRecord objects with the GenBank
file parsed into SeqFeature objects we would need to create the
dictionary with the GenBank FeatureParser:
<<record_parser = GenBank.FeatureParser()
  ncbi_dict = GenBank.NCBIDictionary("nucleotide", "genbank",
                                     parser = record_parser)
>>
  
  Now retrieving a record will give you a SeqRecord object instead of
the raw record:
<<>>> gb_seqrecord = ncbi_dict[gi_list[0]]
  >>> print gb_seqrecord
  <Bio.SeqRecord.SeqRecord instance at 0x102f9404>
>>
  
  Using these automated query retrieval functionality is a big plus over
doing things by hand. Although the module should obey the NCBI's
three-second rule, the NCBI have other recommendations like avoiding
peak hours. See Section 7.1.
  For more information of formats you can parse GenBank records into,
please see section 9.2.2.
  

9.2.2  Parsing GenBank records
==============================
   
  While GenBank files are nice and have lots of information, at the same
time you probably only want to extract a small amount of that
information at a time. The key to doing this is parsing out the
information. Biopython provides GenBank parsers which help you
accomplish this task. Right now the GenBank module provides the
following parsers:
  
  
   1. RecordParser -- This parses the raw record into a GenBank specific
   Record object. This object models the information in a raw record
   very closely, so this is good to use if you are just interested in
   GenBank records themselves.
 
   2. FeatureParser -- This parses the raw record in a SeqRecord object
   with all of the feature table information represented in SeqFeatures
   (see section 10.1 for more info on these objects). This is best to
   use if you are interested in getting things in a more standard
   format. If you use 'Bio.SeqIO' (Chapter 4) to read a GenBank file, it
   will call this FeatureParser for you. 
  
  Depending on the type of GenBank files you are interested in, they
will either contain a single record, or multiple records. Each record
will start with a LOCUS line, various other header lines, a list of
features, and finally the sequence data, ending with a // line.
  Dealing with a GenBank file containing a single record is very easy.
For example, let's use a small bacterial genome, Nanoarchaeum equitans
Kin4-M (RefSeq NC_005213, GenBank AE017199) which can be downloaded from
the NCBI here ( (1)only 1.15 MB):
<<from Bio import GenBank
  feature_parser = GenBank.FeatureParser()
  gb_record = feature_parser.parse(open("AE017199.gbk"))
  # now do something with the record
  print "Name %s, %i features" % (gb_record.name,
len(gb_record.features))
  print repr(gb_record.seq)
>>
  
  Or, using 'Bio.SeqIO' instead (see Chapter 4):
<<from Bio import SeqIO
  gb_record = SeqIO.read(open("AE017199.gbk"), "genbank")
  print "Name %s, %i features" % (gb_record.name,
len(gb_record.features))
  print repr(gb_record.seq)
>>
  
  Either should give the following output:
<<Name AE017199, 1107 features
  Seq('TCTCGCAGAGTTCTTTTTTGTATTAACAAACCCAAAACCCATAGAATTTAATGA...TTA',
IUPACAmbiguousDNA())
>>
  
  

9.2.3  Iterating over GenBank records
=====================================
   
  For multi-record GenBank files, the most common usage will be creating
an iterator, and parsing through the file record by record. Doing this
is very similar to how things are done in other formats, as the
following code demonstrates, using an example file cor6_6.gb (2) which
is included in the BioPython source code under the Tests/GenBank/
directory:
<<from Bio import GenBank
  feature_parser = GenBank.FeatureParser()
  gb_iterator = GenBank.Iterator(open("cor6_6.gb"), feature_parser)
  for cur_record in gb_iterator :
     print "Name %s, %i features" % (cur_record.name,
len(cur_record.features))
     print repr(cur_record.seq)
>>
  
  Or, using 'Bio.SeqIO' instead (see Chapter 4):
<<from Bio import SeqIO
  for cur_record in SeqIO.parse(open("cor6_6.gb"), "genbank") :
     print "Name %s, %i features" % (cur_record.name,
len(cur_record.features))
     print repr(cur_record.seq)
>>
  
  This just iterates over a GenBank file, parsing it into SeqRecord and
SeqFeature objects, and prints out the Seq objects representing the
sequences in the record.
  As with other formats, you have lots of tools for dealing with GenBank
records. This should make it possible to do whatever you need to with
GenBank.
  

9.3  Dealing with alignments
*=*=*=*=*=*=*=*=*=*=*=*=*=*=

  
  It is often very useful to be able to align particular sequences. I do
this quite often to get a quick and dirty idea of relationships between
sequences. Consequently, it is very nice to be able to quickly write up
a python script that does an alignment and gives you back objects that
are easy to work with. The alignment related code in Biopython is meant
to allow python-level access to alignment programs so that you can run
alignments quickly from within scripts.
  

9.3.1  Clustalw
===============
   
  Clustalx (http://www-igbmc.u-strasbg.fr/BioInfo/ClustalX/Top.html) is
a very nice program for doing multiple alignments. Biopython offers
access to alignments in clustal format (these normally have a '*.aln'
extension) that are produced by Clustalx. It also offers access to
clustalw, which the is command line version of clustalx.
  We'll need some sequences to align, such as opuntia.fasta (3) (also
available online here (4)) which is a small FASTA file containing seven
orchid gene DNA sequences, which you can also from 'Doc/examples/' in
the Biopython source distribution.
  The first step in interacting with clustalw is to set up a command
line you want to pass to the program. Clustalw has a ton of command line
options, and if you set a lot of parameters, you can end up typing in a
huge ol' command line quite a bit. This command line class models the
command line by making all of the options be attributes of the class
that can be set. A few convenience functions also exist to set certain
parameters, so that some error checking on the parameters can be done.
  To create a command line object to do a clustalw multiple alignment we
do the following:
<<import os
  from Bio.Clustalw import MultipleAlignCL
  
  cline = MultipleAlignCL(os.path.join(os.curdir, "opuntia.fasta"))
  cline.set_output("test.aln")
>>
  
  First we import the 'MultipleAlignCL' object, which models running a
multiple alignment from clustalw. We then initialize the command line,
with a single argument of the fasta file that we are going to be using
for the alignment. The initialization function also takes an optional
second argument which specifies the location of the 'clustalw'
executable. By default, the commandline will just be invoked with
'clustalw,' assuming that you've got it somewhere on your 'PATH'.
  The second argument sets the output to go to the file 'test.aln'. The
'MultipleAlignCL' object also has numerous other parameters to specify
things like output format, gap costs, etc.
  We can look at the command line we have generated by invoking the
'__str__' member attribute of the 'MultipleAlignCL' class. This is done
by calling 'str(cline)' or simple by printing out the command line with
'print cline'. In this case, doing this would give the following output:
<<clustalw ./opuntia.fasta -OUTFILE=test.aln
>>
  
  Now that we've set up a simple command line, we now want to run the
commandline and collect the results so we can deal with them. This can
be done using the 'do_alignment' function of 'Clustalw' as follows:
<<from Bio import Clustalw
  
  alignment = Clustalw.do_alignment(cline)
>>
  
  What happens when you run this if that Biopython executes your command
line and runs clustalw with the given parameters. It then grabs the
output, and if it is in a format that Biopython can parse (currently
only clustal format), then it will parse the results and return them as
an alignment object of the appropriate type. So in this case since we
are getting results in the default clustal format, the returned
'alignment' object will be a 'ClustalAlignment' type.
  Once we've got this alignment, we can do some interesting things with
it such as get 'seq_record' objects for all of the sequences involved in
the alignment:
<<all_records = alignment.get_all_seqs()
  
  print "description:", all_records[0].description
  print "sequence:", all_records[0].seq
>>
  
  This prints out the description and sequence object for the first
sequence in the alignment:
<<description: gi|6273285|gb|AF191659.1|AF191
  sequence:
Seq('TATACATTAAAGAAGGGGGATGCGGATAAATGGAAAGGCGAAAGAAAGAAAAAAATGAAT
  ...', IUPACAmbiguousDNA())
>>
  
  You can also calculate the maximum length of the alignment with:
<<length = alignment.get_alignment_length()
>>
  
  Finally, to write out the alignment object in the original format, we
just need to access the '__str__' function. So doing a 'print alignment'
gives:
<<CLUSTAL X (1.81) multiple sequence alignment
  
  
  gi|6273285|gb|AF191659.1|AF191     
TATACATTAAAGAAGGGGGATGCGGATAAATGGAAAGGCGAAAGAAAGAA
  gi|6273284|gb|AF191658.1|AF191     
TATACATTAAAGAAGGGGGATGCGGATAAATGGAAAGGCGAAAGAAAGAA
  ...
>>
  
  This makes it easy to write your alignment back into a file with all
of the original info intact.
  If you want to do more interesting things with an alignment, the best
thing to do is to pass the alignment to an alignment information
generating object, such as the SummaryInfo object, described in
section 9.3.2.
  

9.3.2  Calculating summary information
======================================
   
  Once you have an alignment, you are very likely going to want to find
out information about it. Instead of trying to have all of the functions
that can generate information about an alignment in the alignment object
itself, we've tried to separate out the functionality into separate
classes, which act on the alignment.
  Getting ready to calculate summary information about an object is
quick to do. Let's say we've got an alignment object called 'alignment'.
All we need to do to get an object that will calculate summary
information is:
<<from Bio.Align import AlignInfo
  summary_align = AlignInfo.SummaryInfo(alignment)
>>
  
  The 'summary_align' object is very useful, and will do the following
neat things for you:
  
  
   1. Calculate a quick consensus sequence -- see section 9.3.3 
   2. Get a position specific score matrix for the alignment -- see
   section 9.3.4 
   3. Calculate the information content for the alignment -- see
   section 9.3.5 
   4. Generate information on substitutions in the alignment --
   section 9.4 details using this to generate a substitution matrix. 
  
  

9.3.3  Calculating a quick consensus sequence
=============================================
   
  The 'SummaryInfo' object, described in section 9.3.2, provides
functionality to calculate a quick consensus of an alignment. Assuming
we've got a 'SummaryInfo' object called 'summary_align' we can calculate
a consensus by doing:
<<consensus = summary_align.dumb_consensus()
>>
  
  As the name suggests, this is a really simple consensus calculator,
and will just add up all of the residues at each point in the consensus,
and if the most common value is higher than some threshold value (the
default is .3) will add the common residue to the consensus. If it
doesn't reach the threshold, it adds an ambiguity character to the
consensus. The returned consensus object is Seq object whose alphabet is
inferred from the alphabets of the sequences making up the consensus. So
doing a 'print consensus' would give:
<<consensus
Seq('TATACATNAAAGNAGGGGGATGCGGATAAATGGAAAGGCGAAAGAAAGAAAAAAATGAAT
  ...', IUPACAmbiguousDNA())
>>
  
  You can adjust how 'dumb_consensus' works by passing optional
parameters:
  
  
 the threshold  This is the threshold specifying how common a particular
   residue has to be at a position before it is added. The default is
   .7.
 
 the ambiguous character  This is the ambiguity character to use. The
   default is 'N'.
 
 the consensus alphabet  This is the alphabet to use for the consensus
   sequence. If an alphabet is not specified than we will try to guess
   the alphabet based on the alphabets of the sequences in the
   alignment. 
  
  

9.3.4  Position Specific Score Matrices
=======================================
   
  Position specific score matrices (PSSMs) summarize the alignment
information in a different way than a consensus, and may be useful for
different tasks. Basically, a PSSM is a count matrix. For each column in
the alignment, the number of each alphabet letters is counted and
totaled. The totals are displayed relative to some representative
sequence along the left axis. This sequence may be the consesus
sequence, but can also be any sequence in the alignment. For instance
for the alignment,
<<GTATC
  AT--C
  CTGTC
>>
  
  the PSSM is:
<<      G A T C
      G 1 1 0 1
      T 0 0 3 0
      A 1 1 0 0
      T 0 0 2 0
      C 0 0 0 3
>>
  
  Let's assume we've got an alignment object called 'c_align'. To get a
PSSM with the consensus sequence along the side we first get a summary
object and calculate the consensus sequence:
<<summary_align = AlignInfo.SummaryInfo(c_align)
  consensus = summary_align.dumb_consensus()
>>
  
  Now, we want to make the PSSM, but ignore any 'N' ambiguity residues
when calculating this:
<<my_pssm = summary_align.pos_specific_score_matrix(consensus,
                                                    chars_to_ignore =
['N'])
>>
  
  Two notes should be made about this:
  
  
   1. To maintain strictness with the alphabets, you can only include
   characters along the top of the PSSM that are in the alphabet of the
   alignment object. Gaps are not included along the top axis of the
   PSSM.
 
   2. The sequence passed to be displayed along the left side of the
   axis does not need to be the consensus. For instance, if you wanted
   to display the second sequence in the alignment along this axis, you
   would need to do:
   <<second_seq = alignment.get_seq_by_num(1)
     my_pssm = summary_align.pos_specific_score_matrix(second_seq
                                                       chars_to_ignore =
   ['N'])
   >>
 
  
  The command above returns a 'PSSM' object. To print out the PSSM as we
showed above, we simply need to do a 'print my_pssm', which gives:
<<    A   C   G   T
  T  0.0 0.0 0.0 7.0
  A  7.0 0.0 0.0 0.0
  T  0.0 0.0 0.0 7.0
  A  7.0 0.0 0.0 0.0
  C  0.0 7.0 0.0 0.0
  A  7.0 0.0 0.0 0.0
  T  0.0 0.0 0.0 7.0
  T  1.0 0.0 0.0 6.0
  ...
>>
  
  You can access any element of the PSSM by subscripting like
'your_pssm[sequence_number][residue_count_name]'. For instance, to get
the counts for the 'A' residue in the second element of the above PSSM
you would do:
<<>>> print my_pssm[1]["A"]
  7.0
>>
  
  The structure of the PSSM class hopefully makes it easy both to access
elements and to pretty print the matrix.
  

9.3.5  Information Content
==========================
   
  A potentially useful measure of evolutionary conservation is the
information content of a sequence.
  A useful introduction to information theory targetted towards
molecular biologists can be found at
http://www.lecb.ncifcrf.gov/~toms/paper/primer/. For our purposes, we
will be looking at the information content of a consesus sequence, or a
portion of a consensus sequence. We calculate information content at a
particular column in a multiple sequence alignment using the following
formula:
                              N                
                                         (P  ) 
                               a         (   ) 
                        IC    --  P      ( ij) 
                            = \       log(---) 
                          j   /    ij    (Q  ) 
                              --         (   ) 
                              i=1        ( i ) 
  
  where:
  
  
   - IC_j -- The information content for the j-th column in an
   alignment. 
   - N_a -- The number of letters in the alphabet. 
   - P_ij -- The frequency of a particular letter i in the j-th column
   (i. e. if G occured 3 out of 6 times in an aligment column, this
   would be 0.5) 
   - Q_i -- The expected frequency of a letter i. This is an optional
   argument, usage of which is left at the user's discretion. By
   default, it is automatically assigned to 0.05 = 1/20 for a protein
   alphabet, and 0.25 = 1/4 for a nucleic acid alphabet. This is for
   geting the information content without any assumption of prior
   distribtions. When assuming priors, or when using a non-standard
   alphabet, you should supply the values for Q_i. 
  
  Well, now that we have an idea what information content is being
calculated in Biopython, let's look at how to get it for a particular
region of the alignment.
  First, we need to use our alignment to get a alignment summary object,
which we'll assume is called 'summary_align' (see section 9.3.2) for
instructions on how to get this. Once we've got this object, calculating
the information content for a region is as easy as:
<<info_content = summary_align.information_content(5, 30,
                                                   chars_to_ignore =
['N'])
>>
  
  Wow, that was much easier then the formula above made it look! The
variable 'info_content' now contains a float value specifying the
information content over the specified region (from 5 to 30 of the
alignment). We specifically ignore the ambiguity residue 'N' when
calculating the information content, since this value is not included in
our alphabet (so we shouldn't be interested in looking at it!).
  As mentioned above, we can also calculate relative information content
by supplying the expected frequencies:
<<expect_freq = {
      'A' : .3,
      'G' : .2,
      'T' : .3,
      'C' : .2}
>>
  
  The expected should not be passed as a raw dictionary, but instead by
passed as a 'SubsMat.FreqTable' object (see section 10.4.2 for more
information about FreqTables). The FreqTable object provides a standard
for associating the dictionary with an Alphabet, similar to how the
Biopython Seq class works.
  To create a FreqTable object, from the frequency dictionary you just
need to do:
<<from Bio.Alphabet import IUPAC
  from Bio.SubsMat import FreqTable
  
  e_freq_table = FreqTable.FreqTable(expect_freq, FreqTable.FREQ,
                                     IUPAC.unambiguous_dna)
>>
  
  Now that we've got that, calculating the relative information content
for our region of the alignment is as simple as:
<<info_content = summary_align.information_content(5, 30,
                                                   e_freq_table =
e_freq_table,
                                                   chars_to_ignore =
['N'])
>>
  
  Now, 'info_content' will contain the relative information content over
the region in relation to the expected frequencies.
  The value return is calculated using base 2 as the logarithm base in
the formula above. You can modify this by passing the parameter
'log_base' as the base you want:
<<info_content = summary_align.information_content(5, 30, log_base = 10
                                                   chars_to_ignore =
['N'])
>>
  
  Well, now you are ready to calculate information content. If you want
to try applying this to some real life problems, it would probably be
best to dig into the literature on information content to get an idea of
how it is used. Hopefully your digging won't reveal any mistakes made in
coding this function!
  

9.3.6  Translating between Alignment formats
============================================
  
  One thing that you always end up having to do is convert between
different formats. You can do this using the 'Bio.AlignIO' module, see
Section 5.2.1.
  

9.4  Substitution Matrices
*=*=*=*=*=*=*=*=*=*=*=*=*=

   
  Substitution matrices are an extremely important part of everyday
bioinformatics work. They provide the scoring terms for classifying how
likely two different residues are to substitute for each other. This is
essential in doing sequence comparisons. The book "Biological Sequence
Analysis" by Durbin et al. provides a really nice introduction to
Substitution Matrices and their uses. Some famous substitution matrices
are the PAM and BLOSUM series of matrices.
  Biopython provides a ton of common substitution matrices, and also
provides functionality for creating your own substitution matrices.
  

9.4.1  Using common substitution matrices
=========================================
  
  

9.4.2  Creating your own substitution matrix from an alignment
==============================================================
   
  A very cool thing that you can do easily with the substitution matrix
classes is to create your own substitution matrix from an alignment. In
practice, this is normally done with protein alignments. In this
example, we'll first get a biopython alignment object and then get a
summary object to calculate info about the alignment. The file
containing protein.aln (5) (also available online here (6)) contains the
Clustalw alignment output.
<<from Bio import Clustalw
  from Bio.Alphabet import IUPAC
  from Bio.Align import AlignInfo
  
  # get an alignment object from a Clustalw alignment output
  c_align = Clustalw.parse_file("protein.aln", IUPAC.protein)
  summary_align = AlignInfo.SummaryInfo(c_align)
>>
  
  Sections 9.3.1 and 9.3.2 contain more information on doing this.
  Now that we've got our 'summary_align' object, we want to use it to
find out the number of times different residues substitute for each
other. To make the example more readable, we'll focus on only amino
acids with polar charged side chains. Luckily, this can be done easily
when generating a replacement dictionary, by passing in all of the
characters that should be ignored. Thus we'll create a dictionary of
replacements for only charged polar amino acids using:
<<replace_info = summary_align.replacement_dictionary(["G", "A", "V",
"L", "I",
                                                       "M", "P", "F",
"W", "S",
                                                       "T", "N", "Q",
"Y", "C"])
>>
  
  This information about amino acid replacements is represented as a
python dictionary which will look something like:
<<{('R', 'R'): 2079.0, ('R', 'H'): 17.0, ('R', 'K'): 103.0, ('R', 'E'):
2.0,
  ('R', 'D'): 2.0, ('H', 'R'): 0, ('D', 'H'): 15.0, ('K', 'K'): 3218.0,
  ('K', 'H'): 24.0, ('H', 'K'): 8.0, ('E', 'H'): 15.0, ('H', 'H'):
1235.0,
  ('H', 'E'): 18.0, ('H', 'D'): 0, ('K', 'D'): 0, ('K', 'E'): 9.0,
  ('D', 'R'): 48.0, ('E', 'R'): 2.0, ('D', 'K'): 1.0, ('E', 'K'): 45.0,
  ('K', 'R'): 130.0, ('E', 'D'): 241.0, ('E', 'E'): 3305.0,
  ('D', 'E'): 270.0, ('D', 'D'): 2360.0}
>>
  
  This information gives us our accepted number of replacements, or how
often we expect different things to substitute for each other. It turns
out, amazingly enough, that this is all of the information we need to go
ahead and create a substitution matrix. First, we use the replacement
dictionary information to create an Accepted Replacement Matrix (ARM):
<<from Bio import SubsMat
  my_arm = SubsMat.SeqMat(replace_info)
>>
  
  With this accepted replacement matrix, we can go right ahead and
create our log odds matrix (i. e. a standard type Substitution Matrix):
<<my_lom = SubsMat.make_log_odds_matrix(my_arm)
>>
  
  The log odds matrix you create is customizable with the following
optional arguments:
  
  
   - 'exp_freq_table' -- You can pass a table of expected frequencies
   for each alphabet. If supplied, this will be used instead of the
   passed accepted replacement matrix when calculate expected
   replacments.
 
   - 'logbase' - The base of the logarithm taken to create the log odd
   matrix. Defaults to base 10.
 
   - 'factor' - The factor to multiply each matrix entry by. This
   defaults to 10, which normally makes the matrix numbers easy to work
   with.
 
   - 'round_digit' - The digit to round to in the matrix. This defaults
   to 0 (i. e. no digits).
  
  Once you've got your log odds matrix, you can display it prettily
using the function 'print_mat'. Doing this on our created matrix gives:
<<>>> my_lom.print_mat()
  D   6
  E  -5   5
  H -15 -13  10
  K -31 -15 -13   6
  R -13 -25 -14  -7   7
     D   E   H   K   R
>>
  
  Very nice. Now we've got our very own substitution matrix to play
with!
  

9.5  BioSQL -- storing sequences in a relational database
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*

    BioSQL (7) is a joint effort between the OBF (8) projects (BioPerl,
BioJava etc) to support a shared database schema for storing sequence
data. In theory, you could load a GenBank file into the database with
BioPerl, then using Biopython extract this from the database as a record
object with featues - and get more or less the same thing as if you had
loaded the GenBank file directly as a SeqRecord using 'Bio.SeqIO'
(Chapter 4).
  Biopython's BioSQL module is currently documented at
http://biopython.org/wiki/BioSQL which is part of our wiki pages.
  

9.6  BioCorba
*=*=*=*=*=*=*

  
  Biocorba does some cool stuff with CORBA. Basically, it allows you to
easily interact with code written in other languages, including Perl and
Java. This is all done through an interface which is very similar to the
standard biopython interface. Much work has been done to make it easy to
use knowing only very little about CORBA. You should check out the
biocorba specific documentation, which describes in detail how to use
it.
  

9.7  Going 3D: The PDB module
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*

  
  Biopython also allows you to explore the extensive realm of
macromolecular structure. Biopython comes with a PDBParser class that
produces a Structure object. The Structure object can be used to access
the atomic data in the file in a convenient manner.
  

9.7.1  Structure representation
===============================
  
  A macromolecular structure is represented using a structure, model
chain, residue, atom (or SMCRA) hierarchy. Fig. 9.7.1 shows a UML class
diagram of the SMCRA data structure. Such a data structure is not
necessarily best suited for the representation of the macromolecular
content of a structure, but it is absolutely necessary for a good
interpretation of the data present in a file that describes the
structure (typically a PDB or MMCIF file). If this hierarchy cannot
represent the contents of a structure file, it is fairly certain that
the file contains an error or at least does not describe the structure
unambiguously. If a SMCRA data structure cannot be generated, there is
reason to suspect a problem. Parsing a PDB file can thus be used to
detect likely problems. We will give several examples of this in section
9.7.5.1.
    *images/smcra.png* 
  
  Structure, Model, Chain and Residue are all subclasses of the Entity
base class. The Atom class only (partly) implements the Entity interface
(because an Atom does not have children).
  For each Entity subclass, you can extract a child by using a unique id
for that child as a key (e.g. you can extract an Atom object from a
Residue object by using an atom name string as a key, you can extract a
Chain object from a Model object by using its chain identifier as a
key).
  Disordered atoms and residues are represented by DisorderedAtom and
DisorderedResidue classes, which are both subclasses of the
DisorderedEntityWrapper base class. They hide the complexity associated
with disorder and behave exactly as Atom and Residue objects.
  In general, a child Entity object (i.e. Atom, Residue, Chain, Model)
can be extracted from its parent (i.e. Residue, Chain, Model, Structure,
respectively) by using an id as a key.
<<child_entity=parent_entity[child_id]
>>
  
  You can also get a list of all child Entities of a parent Entity
object. Note that this list is sorted in a specific way (e.g. according
to chain identifier for Chain objects in a Model object).
<<child_list=parent_entity.get_list()
>>
  
  You can also get the parent from a child.
<<parent_entity=child_entity.get_parent()
>>
  
  At all levels of the SMCRA hierarchy, you can also extract a full id.
The full id is a tuple containing all id's starting from the top object
(Structure) down to the current object. A full id for a Residue object
e.g. is something like:
<<full_id=residue.get_full_id()
  
  print full_id
  
  ("1abc", 0, "A", ("", 10, "A"))
>>
  
  This corresponds to:
  
  
   - The Structure with id "1abc" 
   - The Model with id 0 
   - The Chain with id "A" 
   - The Residue with id (" ", 10, "A"). 
   The Residue id indicates that the residue is not a hetero-residue
(nor a water) because it has a blanc hetero field, that its sequence
identifier is 10 and that its insertion code is "A".
  Some other useful methods:
<<# get the entity's id
  
  entity.get_id()
  
  # check if there is a child with a given id
  
  entity.has_id(entity_id)
  
  # get number of children
  
  nr_children=len(entity)
>>
  
  It is possible to delete, rename, add, etc. child entities from a
parent entity, but this does not include any sanity checks (e.g. it is
possible to add two residues with the same id to one chain). This really
should be done via a nice Decorator class that includes integrity
checking, but you can take a look at the code (Entity.py) if you want to
use the raw interface.
  

9.7.1.1  Structure
------------------
  
  The Structure object is at the top of the hierarchy. Its id is a user
given string. The Structure contains a number of Model children. Most
crystal structures (but not all) contain a single model, while NMR
structures typically consist of several models. Disorder in crystal
structures of large parts of molecules can also result in several
models.
9.7.1.1.1  Constructing a Structure object
  
  A Structure object is produced by a PDBParser object:
<<from Bio.PDB.PDBParser import PDBParser
  
  p=PDBParser(PERMISSIVE=1)
  
  structure_id="1fat"
  
  filename="pdb1fat.ent"
  
  s=p.get_structure(structure_id, filename)
>>
  
  The PERMISSIVE flag indicates that a number of common problems (see
9.7.5.1) associated with PDB files will be ignored (but note that some
atoms and/or residues will be missing). If the flag is not present a
PDBConstructionException will be generated during the parse operation.
9.7.1.1.2  Header and trailer
  
  You can extract the header and trailer (simple lists of strings) of
the PDB file from the PDBParser object with the get_header and
get_trailer methods.
  

9.7.1.2  Model
--------------
  
  The id of the Model object is an integer, which is derived from the
position of the model in the parsed file (they are automatically
numbered starting from 0). The Model object stores a list of Chain
children.
9.7.1.2.1  Example
  
  Get the first model from a Structure object.
<<first_model=structure[0]
>>
  
  

9.7.1.3  Chain
--------------
  
  The id of a Chain object is derived from the chain identifier in the
structure file, and can be any string. Each Chain in a Model object has
a unique id. The Chain object stores a list of Residue children.
9.7.1.3.1  Example
  
  Get the Chain object with identifier "A" from a Model object.
<<chain_A=model["A"]
>>
  
  

9.7.1.4  Residue
----------------
  
  Unsurprisingly, a Residue object stores a set of Atom children. In
addition, it also contains a string that specifies the residue name
(e.g. "ASN") and the segment identifier of the residue (well known to
X-PLOR users, but not used in the construction of the SMCRA data
structure).
  The id of a Residue object is composed of three parts: the hetero
field (hetfield), the sequence identifier (resseq) and the insertion
code (icode).
  The hetero field is a string : it is "W" for waters, "H_" followed by
the residue name (e.g. "H_FUC") for other hetero residues and blank for
standard amino and nucleic acids. This scheme is adopted for reasons
described in section 9.7.3.1.
  The second field in the Residue id is the sequence identifier, an
integer describing the position of the residue in the chain.
  The third field is a string, consisting of the insertion code. The
insertion code is sometimes used to preserve a certain desirable residue
numbering scheme. A Ser 80 insertion mutant (inserted e.g. between a Thr
80 and an Asn 81 residue) could e.g. have sequence identifiers and
insertion codes as followed: Thr 80 A, Ser 80 B, Asn 81. In this way the
residue numbering scheme stays in tune with that of the wild type
structure.
  Let's give some examples. Asn 10 with a blank insertion code would
have residue id (" ", 10, " "). Water 10 would have residue id ("W", 10,
" "). A glucose molecule (a hetero residue with residue name GLC) with
sequence identifier 10 would have residue id ("H_GLC", 10, " "). In this
way, the three residues (with the same insertion code and sequence
identifier) can be part of the same chain because their residue id's are
distinct.
  In most cases, the hetflag and insertion code fields will be blank,
e.g. (" ", 10, " "). In these cases, the sequence identifier can be used
as a shortcut for the full id:
<<# use full id
  
  res10=chain[("", 10, "")]
  
  # use shortcut
  
  res10=chain[10]
>>
  
  Each Residue object in a Chain object should have a unique id.
However, disordered residues are dealt with in a special way, as
described in section 9.7.2.3.2.
  A Residue object has a number of additional methods:
<<r.get_resname()  # return residue name, e.g. "ASN"
  r.get_segid()  # return the SEGID, e.g. "CHN1"
>>
  
  

9.7.1.5  Atom
-------------
  
  The Atom object stores the data associated with an atom, and has no
children. The id of an atom is its atom name (e.g. "OG" for the side
chain oxygen of a Ser residue). An Atom id needs to be unique in a
Residue. Again, an exception is made for disordered atoms, as described
in section 9.7.2.2.
  In a PDB file, an atom name consists of 4 chars, typically with
leading and trailing spaces. Often these spaces can be removed for ease
of use (e.g. an amino acid C alpha  atom is labeled ".CA." in a PDB
file, where the dots represent spaces). To generate an atom name (and
thus an atom id) the spaces are removed, unless this would result in a
name collision in a Residue (i.e. two Atom objects with the same atom
name and id). In the latter case, the atom name including spaces is
tried. This situation can e.g. happen when one residue contains atoms
with names ".CA." and "CA..", although this is not very likely.
  The atomic data stored includes the atom name, the atomic coordinates
(including standard deviation if present), the B factor (including
anisotropic B factors and standard deviation if present), the altloc
specifier and the full atom name including spaces. Less used items like
the atom element number or the atomic charge sometimes specified in a
PDB file are not stored.
  An Atom object has the following additional methods:
<<a.get_name()       # atom name (spaces stripped, e.g. "CA")
  a.get_id()         # id (equals atom name)
  a.get_coord()      # atomic coordinates
  a.get_bfactor()    # B factor
  a.get_occupancy()  # occupancy
  a.get_altloc()     # alternative location specifie
  a.get_sigatm()     # std. dev. of atomic parameters
  a.get_siguij()     # std. dev. of anisotropic B factor
  a.get_anisou()     # anisotropic B factor
  a.get_fullname()   # atom name (with spaces, e.g. ".CA.")
>>
  
  To represent the atom coordinates, siguij, anisotropic B factor and
sigatm Numpy arrays are used.
  

9.7.2  Disorder
===============
  
  

9.7.2.1  General approach
-------------------------
  
  Disorder should be dealt with from two points of view: the atom and
the residue points of view. In general, we have tried to encapsulate all
the complexity that arises from disorder. If you just want to loop over
all C alpha  atoms, you do not care that some residues have a disordered
side chain. On the other hand it should also be possible to represent
disorder completely in the data structure. Therefore, disordered atoms
or residues are stored in special objects that behave as if there is no
disorder. This is done by only representing a subset of the disordered
atoms or residues. Which subset is picked (e.g. which of the two
disordered OG side chain atom positions of a Ser residue is used) can be
specified by the user.
  

9.7.2.2  Disordered atoms
-------------------------
  
  Disordered atoms are represented by ordinary Atom objects, but all
Atom objects that represent the same physical atom are stored in a
DisorderedAtom object. Each Atom object in a DisorderedAtom object can
be uniquely indexed using its altloc specifier. The DisorderedAtom
object forwards all uncaught method calls to the selected Atom object,
by default the one that represents the atom with with the highest
occupancy. The user can of course change the selected Atom object,
making use of its altloc specifier. In this way atom disorder is
represented correctly without much additional complexity. In other
words, if you are not interested in atom disorder, you will not be
bothered by it.
  Each disordered atom has a characteristic altloc identifier. You can
specify that a DisorderedAtom object should behave like the Atom object
associated with a specific altloc identifier:
<<atom.disordered\_select("A")  # select altloc A atom
  
  print atom.get_altloc()
  "A"
  
  atom.disordered_select("B")     # select altloc B atom
  print atom.get_altloc()
  "B"
>>
  
  

9.7.2.3  Disordered residues
----------------------------
  
9.7.2.3.1  Common case
  
  The most common case is a residue that contains one or more disordered
atoms. This is evidently solved by using DisorderedAtom objects to
represent the disordered atoms, and storing the DisorderedAtom object in
a Residue object just like ordinary Atom objects. The DisorderedAtom
will behave exactly like an ordinary atom (in fact the atom with the
highest occupancy) by forwarding all uncaught method calls to one of the
Atom objects (the selected Atom object) it contains.
9.7.2.3.2  Point mutations
  
  A special case arises when disorder is due to a point mutation, i.e.
when two or more point mutants of a polypeptide are present in the
crystal. An example of this can be found in PDB structure 1EN2.
  Since these residues belong to a different residue type (e.g. let's
say Ser 60 and Cys 60) they should not be stored in a single Residue
object as in the common case. In this case, each residue is represented
by one Residue object, and both Residue objects are stored in a
DisorderedResidue object.
  The DisorderedResidue object forwards all uncaught methods to the
selected Residue object (by default the last Residue object added), and
thus behaves like an ordinary residue. Each Residue object in a
DisorderedResidue object can be uniquely identified by its residue name.
In the above example, residue Ser 60 would have id "SER" in the
DisorderedResidue object, while residue Cys 60 would have id "CYS". The
user can select the active Residue object in a DisorderedResidue object
via this id.
  

9.7.3  Hetero residues
======================
  
  

9.7.3.1  Associated problems
----------------------------
  
  A common problem with hetero residues is that several hetero and
non-hetero residues present in the same chain share the same sequence
identifier (and insertion code). Therefore, to generate a unique id for
each hetero residue, waters and other hetero residues are treated in a
different way.
  Remember that Residue object have the tuple (hetfield, resseq, icode)
as id. The hetfield is blank (" ") for amino and nucleic acids, and a
string for waters and other hetero residues. The content of the hetfield
is explained below.
  

9.7.3.2  Water residues
-----------------------
  
  The hetfield string of a water residue consists of the letter "W". So
a typical residue id for a water is ("W", 1, " ").
  

9.7.3.3  Other hetero residues
------------------------------
  
  The hetfield string for other hetero residues starts with "H_"
followed by the residue name. A glucose molecule e.g. with residue name
"GLC" would have hetfield "H_GLC". It's residue id could e.g. be
("H_GLC", 1, " ").
  

9.7.4  Some random usage examples
=================================
  
  Parse a PDB file, and extract some Model, Chain, Residue and Atom
objects.
<<from PDBParser import PDBParser
  
  parser=PDBParser()
  
  structure=parser.get_structure("test", "1fat.pdb")
  model=structure[0]
  chain=model["A"]
  residue=chain[1]
  atom=residue["CA"]
>>
  
  Extract a hetero residue from a chain (e.g. a glucose (GLC) moiety
with resseq 10).
<<residue_id=("H_GLC", 10, " ")
  residue=chain[residue_id]
>>
  
  Print all hetero residues in chain.
<<for residue in chain.get_list():
   residue_id=residue.get_id()
   hetfield=residue_id[0]
   if hetfield[0]=="H":
    print residue_id
>>
  
  Print out the coordinates of all CA atoms in a structure with B factor
greater than 50.
<<for model in structure.get_list():
    for chain in model.get_list():
      for residue in chain.get_list():
        if residue.has_id("CA"):
          ca=residue["CA"]
          if ca.get_bfactor()>50.0:
            print ca.get_coord()
>>
  
  Print out all the residues that contain disordered atoms.
<<for model in structure.get_list()
    for chain in model.get_list():
      for residue in chain.get_list():
        if residue.is_disordered():
          resseq=residue.get_id()[1]
          resname=residue.get_resname()
          model_id=model.get_id()
          chain_id=chain.get_id()
          print model_id, chain_id, resname, resseq
>>
  
  Loop over all disordered atoms, and select all atoms with altloc A (if
present). This will make sure that the SMCRA data structure will behave
as if only the atoms with altloc A are present.
<<for model in structure.get_list()
    for chain in model.get_list():
      for residue in chain.get_list():
        if residue.is_disordered():
          for atom in residue.get_list():
            if atom.is_disordered():
              if atom.disordered_has_id("A"):
                atom.disordered_select("A")
>>
  
  Suppose that a chain has a point mutation at position 10, consisting
of a Ser and a Cys residue. Make sure that residue 10 of this chain
behaves as the Cys residue.
<<residue=chain[10]
  residue.disordered_select("CYS")
>>
  
  

9.7.5  Common problems in PDB files
===================================
  
  

9.7.5.1  Examples
-----------------
  
  The PDBParser/Structure class was tested on about 800 structures (each
belonging to a unique SCOP superfamily). This takes about 20 minutes, or
on average 1.5 seconds per structure. Parsing the structure of the large
ribosomal subunit (1FKK), which contains about 64000 atoms, takes 10
seconds on a 1000 MHz PC.
  Three exceptions were generated in cases where an unambiguous data
structure could not be built. In all three cases, the likely cause is an
error in the PDB file that should be corrected. Generating an exception
in these cases is much better than running the chance of incorrectly
describing the structure in a data structure.
9.7.5.1.1  Duplicate residues
  
  One structure contains two amino acid residues in one chain with the
same sequence identifier (resseq 3) and icode. Upon inspection it was
found that this chain contains the residues Thr A3, ..., Gly A202, Leu
A3, Glu A204. Clearly, Leu A3 should be Leu A203. A couple of similar
situations exist for structure 1FFK (which e.g. contains Gly B64, Met
B65, Glu B65, Thr B67, i.e. residue Glu B65 should be Glu B66).
9.7.5.1.2  Duplicate atoms
  
  Structure 1EJG contains a Ser/Pro point mutation in chain A at
position 22. In turn, Ser 22 contains some disordered atoms. As
expected, all atoms belonging to Ser 22 have a non-blank altloc
specifier (B or C). All atoms of Pro 22 have altloc A, except the N atom
which has a blank altloc. This generates an exception, because all atoms
belonging to two residues at a point mutation should have non-blank
altloc. It turns out that this atom is probably shared by Ser and Pro
22, as Ser 22 misses the N atom. Again, this points to a problem in the
file: the N atom should be present in both the Ser and the Pro residue,
in both cases associated with a suitable altloc identifier.
  

9.7.5.2  Automatic correction
-----------------------------
  
  Some errors are quite common and can be easily corrected without much
risk of making a wrong interpretation. These cases are listed below.
9.7.5.2.1  A blank altloc for a disordered atom
  
  Normally each disordered atom should have a non-blanc altloc
identifier. However, there are many structures that do not follow this
convention, and have a blank and a non-blank identifier for two
disordered positions of the same atom. This is automatically interpreted
in the right way.
9.7.5.2.2  Broken chains
  
  Sometimes a structure contains a list of residues belonging to chain
A, followed by residues belonging to chain B, and again followed by
residues belonging to chain A, i.e. the chains are "broken". This is
correctly interpreted.
  

9.7.5.3  Fatal errors
---------------------
  
  Sometimes a PDB file cannot be unambiguously interpreted. Rather than
guessing and risking a mistake, an exception is generated, and the user
is expected to correct the PDB file. These cases are listed below.
9.7.5.3.1  Duplicate residues
  
  All residues in a chain should have a unique id. This id is generated
based on:
  
  
   - The sequence identifier (resseq). 
   - The insertion code (icode). 
   - The hetfield string ("W" for waters and "H_" followed by the
   residue name for other hetero residues) 
   - The residue names of the residues in the case of point mutations
   (to store the Residue objects in a DisorderedResidue object). 
   If this does not lead to a unique id something is quite likely wrong,
and an exception is generated.
9.7.5.3.2  Duplicate atoms
  
  All atoms in a residue should have a unique id. This id is generated
based on:
  
  
   - The atom name (without spaces, or with spaces if a problem arises).
   
   - The altloc specifier. 
   If this does not lead to a unique id something is quite likely wrong,
and an exception is generated.
  

9.7.6  Other features
=====================
  
  There are also some tools to analyze a crystal structure. Tools exist
to superimpose two coordinate sets (SVDSuperimposer), to extract
polypeptides from a structure (Polypeptide), to perform neighbor lookup
(NeighborSearch) and to write out PDB files (PDBIO). The neighbor lookup
is done using a KD tree module written in C++. It is very fast and also
includes a fast method to find all point pairs within a certain distance
of each other.
  A Polypeptide object is simply a UserList of Residue objects. You can
construct a list of Polypeptide objects from a Structure object as
follows:
<<model_nr=1
  polypeptide_list=build_peptides(structure, model_nr)
  
  for polypeptide in polypeptide_list:
      print polypeptide
>>
  
  The Polypeptide objects are always created from a single Model (in
this case model 1).
  

9.8  Bio.PopGen: Population genetics
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=

  
  Bio.PopGen is a new Biopython module supporting population genetics,
available in Biopython 1.44 onwards.
  The medium term objective for the module is to support widely used
data formats, applications and databases. This module is currently under
intense development and support for new features should appear at a
rather fast pace. Unfortunately this might also entail some instability
on the API, especially if you are using a CVS version. APIs that are
made available on public versions should be much stabler.
  

9.8.1  GenePop
==============
  
  GenePop (http://genepop.curtin.edu.au/) is a popular population
genetics software package supporting Hardy-Weinberg tests, linkage
desiquilibrium, population diferentiation, basic statistics, F_st and
migration estimates, among others. GenePop does not supply sequence
based statistics as it doesn't handle sequence data. The GenePop file
format is supported by a wide range of other population genetic software
applications, thus making it a relevant format in the population
genetics field.
  Bio.PopGen provides a parser and generator of GenePop file format.
Utilities to manipulate the content of a record are also provided. Here
is an example on how to read a GenePop file (you can find example
GenePop data files in the Test/PopGen directory of Biopython):
<<from Bio.PopGen import GenePop
  
  handle = open("example.gen")
  rec = GenePop.parse(handle)
  handle.close()
>>
  
  This will read a file called example.gen and parse it. If you do print
rec, the record will be output again, in GenePop format.
  The most important information in rec will be the loci names and
population information (but there is more -- use help(GenePop.Record) to
check the API documentation). Loci names can be found on rec.loci_list.
Population information can be found on rec.populations. Populations is a
list with one element per population. Each element is itself a list of
individuals, each individual is a pair composed by individual name and a
list of alleles (2 per marker), here is an example for rec.populations:
<<[
      [
          ('Ind1', [(1, 2),    (3, 3), (200, 201)],
          ('Ind2', [(2, None), (3, 3), (None, None)],
      ],
      [
          ('Other1', [(1, 1),  (4, 3), (200, 200)],
      ]
  ]
>>
  
  So we have two populations, the first with two individuals, the second
with only one. The first individual of the first population is called
Ind1, allelic information for each of the 3 loci follows. Please note
that for any locus, information might be missing (see as an example,
Ind2 above).
  A few utility functions to manipulate GenePop records are made
available, here is an example:
<<from Bio.PopGen import GenePop
  
  #Imagine that you have loaded rec, as per the code snippet above...
  
  rec.remove_population(pos)
  #Removes a population from a record, pos is the population position in
  #  rec.populations, remember that it starts on position 0.
  #  rec is altered.
  
  rec.remove_locus_by_position(pos)
  #Removes a locus by its position, pos is the locus position in
  #  rec.loci_list, remember that it starts on position 0.
  #  rec is altered.
  
  rec.remove_locus_by_name(name)
  #Removes a locus by its name, name is the locus name as in
  #  rec.loci_list. If the name doesn't exist the function fails
  #  silently.
  #  rec is altered.
  
  rec_loci = rec.split_in_loci()
  #Splits a record in loci, that is, for each loci, it creates a new
  #  record, with a single loci and all populations.
  #  The result is returned in a dictionary, being each key the locus
name.
  #  The value is the GenePop record.
  #  rec is not altered.
  
  rec_pops =  rec.split_in_pops(pop_names)
  #Splits a record in populations, that is, for each population, it
creates
  #  a new record, with a single population and all loci.
  #  The result is returned in a dictionary, being each key
  #  the population name. As population names are not available in
GenePop,
  #  they are passed in array (pop_names).
  #  The value of each dictionary entry is the GenePop record.
  #  rec is not altered.
>>
  
  GenePop does not support population names, a limitation which can be
cumbersome at times. Functionality to enable population names is
currently being planned for Biopython. These extensions won't break
compatibility in any way with the standard format. In the medium term,
we would also like to support the GenePop web service.
  

9.8.2  Coalescent simulation
============================
  
  A coalescent simulation is a backward model of population genetics
with relation to time. A simulation of ancestry is done until the Most
Recent Common Ancestor (MRCA) is found. This ancestry relationship
starting on the MRCA and ending on the current generation sample is
sometimes called a genealogy. Simple cases assume a population of
constant size in time, haploidy, no population structure, and simulate
the alleles of a single locus under no selection pressure.
  Coalescent theory is used in many fields like selection detection,
estimation of demographic parameters of real populations or disease gene
mapping.
  The strategy followed in the Biopython implementation of the
coalescent was not to create a new, built-in, simulator from scratch but
to use an existing one, SIMCOAL2
(http://cmpg.unibe.ch/software/simcoal2/). SIMCOAL2 allows for, among
others, population structure, multiple demographic events, simulation of
multiple types of loci (SNPs, sequences, STRs/microsatellites and RFLPs)
with recombination, diploidy multiple chromosomes or ascertainment bias.
Notably SIMCOAL2 doesn't support any selection model. We recommend
reading SIMCOAL2's documentation, available in the link above.
  The input for SIMCOAL2 is a file specifying the desired demography and
genome, the output is a set of files (typically around 1000) with the
simulated genomes of a sample of individuals per subpopulation. This set
of files can be used in many ways, like to compute confidence intervals
where which certain statistics (e.g., F_st or Tajima D) are expected to
lie. Real population genetics datasets statistics can then be compared
to those confidence intervals.
  Biopython coalescent code allows to create demographic scenarios and
genomes and to run SIMCOAL2.
  

9.8.2.1  Creating scenarios
---------------------------
  
  Creating a scenario involves both creating a demography and a
chromosome structure. In many cases (e.g. when doing Approximate
Bayesian Computations -- ABC) it is important to test many parameter
variations (e.g. vary the effective population size, N_e, between 10,
50, 500 and 1000 individuals). The code provided allows for the
simulation of scenarios with different demographic parameters very
easily.
  Below we see how we can create scenarios and then how simulate them.
9.8.2.1.1  Demography
  
  A few predefined demographies are built-in, all have two shared
parameters: sample size (called sample_size on the template, see below
for its use) per deme and deme size, i.e. subpopulation size (pop_size).
All demographies are available as templates where all parameters can be
varied, each template has a system name. The prefedined
demographies/templates are:
  
  
 Single population, constant size  The standard parameters are enough to
   specifity it. Template name: simple. 
 Single population, bottleneck  As seen on figure 9.8.2.1.1. The
   parameters are current population size (pop_size on template ne3 on
   figure), time of expansion, given as the generation in the past when
   it occured (expand_gen),  effective population size during bottleneck
   (ne2), time of contraction (contract_gen) and original size in the
   remote past (ne3). Template name: bottle. 
 Island model  The typical island model. The total number of demes is
   specified by total_demes and the migration rate by mig. Template name
   island. 
 Stepping stone model - 1 dimension  The stepping stone model in 1
   dimension, extremes disconnected. The total number of demes is
   total_demes, migration rate is mig. Template name is ssm_1d. 
 Stepping stone model - 2 dimensions  The stepping stone model in 2
   dimensions, extremes disconnected. The parameters are x for the
   horizontal dimension and y for the vertical (being the total number
   of demes x times y), migration rate is mig. Template name is ssm_2d. 
  
    *images/bottle.png* 
  
  In our first example, we will generate a template for a single
population, constant size model with a sample size of 30 and a deme size
of 500. The code for this is:
<<from Bio.PopGen.SimCoal.Template import generate_simcoal_from_template
  
  generate_simcoal_from_template('simple',
      [(1, [('SNP', [24, 0.0005, 0.0])])],
      [('sample_size', [30]),
      ('pop_size', [100])])
>>
  
  Executing this code snippet will generate a file on the current
directory called simple_100_300.par this file can be given as input to
SIMCOAL2 to simulate the demography (below we will see how Biopython can
take care of calling SIMCOAL2).
  This code consists of a single function call, lets discuss it paramter
by parameter.
  The first parameter is the template id (from the list above). We are
using the id 'simple' which is the template for a single population of
constant size along time.
  The second parameter is the chromosome structure. Please ignore it for
now, it will be explained in the next section.
  The third parameter is a list of all required parameters (recall that
the simple model only needs sample_size and pop_size) and possible
values (in this case each parameter only has a possible value).
  Now, lets consider an example where we want to generate several island
models, and we are interested in varying the number of demes: 10, 50 and
100 with a migration rate of 1%. Sample size and deme size will be the
same as before. Here is the code:
<<from Bio.PopGen.SimCoal.Template import generate_simcoal_from_template
  
  generate_simcoal_from_template('island',
      [(1, [('SNP', [24, 0.0005, 0.0])])],
      [('sample_size', [30]),
      ('pop_size', [100]),
      ('mig', [0.01]),
      ('total_demes', [10, 50, 100])])
>>
  
  In this case, 3 files will be generated: island_100_0.01_100_30.par,
island_10_0.01_100_30.par and island_50_0.01_100_30.par. Notice the rule
to make file names: template name, followed by parameter values in
reverse order.
  A few, arguably more esoteric template demographies exist (please
check the Bio/PopGen/SimCoal/data directory on Biopython source tree).
Furthermore it is possible for the user to create new templates. That
functionality will be discussed in a future version of this document.
9.8.2.1.2  Chromosome structure
  
  We strongly recommend reading SIMCOAL2 documentation to understand the
full potential available in modeling chromosome structures. In this
subsection we only discuss how to implement chromosome structures using
the Biopython interface, not the underlying SIMCOAL2 capabilities.
  We will start by implementing a single chromosome, with 24 SNPs with a
recombination rate immediately on the right of each locus of 0.0005 and
a minimum frequency of the minor allele of 0. This will be specified by
the following list (to be passed as second parameter to the function
generate_simcoal_from_template):
<<[(1, [('SNP', [24, 0.0005, 0.0])])]
>>
  
  This is actually the chromosome structure used in the above examples.
  The chromosome structure is represented by a list of chromosomes, each
chromosome (i.e., each element in the list) is composed by a tuple (a
pair): the first element is the number of times the chromosome is to be
repeated (as there might be interest in repeating the same chromosome
many times). The second element is a list of the actual components of
the chromosome. Each element is again a pair, the first member is the
locus type and the second element the parameters for that locus type.
Confused? Before showing more examples lets review the example above: We
have a list with one element (thus one chromosome), the chromosome is a
single instance (therefore not to be repeated), it is composed of 24
SNPs, with a recombination rate of 0.0005 between each consecutive SNP,
the minimum frequency of the minor allele is 0.0 (i.e, it can be absent
from a certain population).
  Lets see a more complicated example:
<<[
    (5, [
         ('SNP', [24, 0.0005, 0.0])
        ]
    ),
    (2, [
         ('DNA', [10, 0.0, 0.00005, 0.33]),
         ('RFLP', [1, 0.0, 0.0001]),
         ('MICROSAT', [1, 0.0, 0.001, 0.0, 0.0])
        ]
    )
  ]
>>
  
  We start by having 5 chromosomes with the same structure as above
(i.e., 24 SNPs). We then have 2 chromosomes which have a DNA sequence
with 10 nucleotides, 0.0 recombination rate, 0.0005 mutation rate, and a
transition rate of 0.33. Then we have an RFLP with 0.0 recombination
rate to the next locus and a 0.0001 mutation rate. Finally we have a
microsatellite (or STR), with 0.0 recombination rate to the next locus
(note, that as this is a single microsatellite which has no loci
following, this recombination rate here is irrelevant), with a mutation
rate of 0.001, geometric paramater of 0.0 and a range constraint of 0.0
(for information about this parameters please consult the SIMCOAL2
documentation, you can use them to simulate various mutation models,
including the typical -- for microsatellites -- stepwise mutation model
among others).
  

9.8.2.2  Running SIMCOAL2
-------------------------
  
  We now discuss how to run SIMCOAL2 from inside Biopython. It is
required that the binary for SIMCOAL2 is called simcoal2 (or
simcoal2.exe on Windows based platforms), please note that the typical
name when downloading the program is in the format simcoal2_x_y. As such
renaming of the binary after download is needed.
  It is possible to run SIMCOAL2 on files that were not generated using
the method above (e.g., writing a parameter file by hand), but we will
show an example by creating a model using the framework presented above.
<<from Bio.PopGen.SimCoal.Template import generate_simcoal_from_template
  from Bio.PopGen.SimCoal.Controller import SimCoalController
  
  
  generate_simcoal_from_template('simple',
      [
        (5, [
             ('SNP', [24, 0.0005, 0.0])
            ]
        ),
        (2, [
             ('DNA', [10, 0.0, 0.00005, 0.33]),
             ('RFLP', [1, 0.0, 0.0001]),
             ('MICROSAT', [1, 0.0, 0.001, 0.0, 0.0])
            ]
        )
      ],
      [('sample_size', [30]),
      ('pop_size', [100])])
  
  ctrl = SimCoalController('.')
  ctrl.run_simcoal('simple_100_30.par', 50)
>>
  
  The lines of interest are the last two (plus the new import). Firstly
a controller for the application is created. The directory where the
binary is located has to be specified.
  The simulator is then run on the last line: we know, from the rules
explained above, that the input file name is simple_100_30.par for the
simulation parameter file created. We then specify that we want to run
50 independent simulations, by default Biopython requests a simulation
of diploid data, but a third parameter can be added to simulate haploid
data (adding as a parameter the string '0'). SIMCOAL2 will now run
(please note that this can take quite a lot of time) and will create a
directory with the simulation results. The results can now be analysed
(typically studying the data with Arlequin3). In the future Biopython
might support reading the Arlequin3 format and thus allowing for the
analysis of SIMCOAL2 data inside Biopython.
  

9.8.3  Other applications
=========================
  
  Here we discuss interfaces and utilities to deal with population
genetics' applications which arguably have a smaller user base.
  

9.8.3.1  FDist: Detecting selection and molecular adaptation
------------------------------------------------------------
  
  FDist is a selection detection application suite based on computing
(i.e. simulating) a "neutral" confidence interval based on F_st and
heterozygosity. Markers (which can be SNPs, microsatellites, AFLPs among
others) which lie outside the "neutral" interval are to be considered as
possible candidates for being under selection.
  FDist is mainly used when the number of markers is considered enough
to estimate an average F_st, but not enough to either have outliers
calculated from the dataset directly or, with even more markers for
which the relative positions in the genome are known, to use approaches
based on, e.g., Extended Haplotype Heterozygosity (EHH).
  The typical usage pattern for FDist is as follows:
  
  
   1. Import a dataset from an external format into FDist format. 
   2. Compute average F_st. This is done by datacal inside FDist. 
   3. Simulate "neutral" markers based on the average F_st and expected
   number of total populations. This is the core operation, done by
   fdist inside FDist. 
   4. Calculate the confidence interval, based on the desired confidence
   boundaries (typically 95% or 99%). This is done by cplot and is
   mainly used to plot the interval. 
   5. Assess each marker status against the simulation "neutral"
   confidence interval. Done by pv. This is used to detect the outlier
   status of each marker against the simulation. 
  
  We will now discuss each step with illustrating example code (for this
example to work FDist binaries have to be on the executable PATH).
  The FDist data format is application specific and is not used at all
by other applications, as such you will probably have to convert your
data for use with FDist. Biopython can help you do this. Here is an
example converting from GenePop format to FDist format (along with
imports that will be needed on examples further below):
<<from Bio.PopGen import GenePop
  from Bio.PopGen import FDist
  from Bio.PopGen.FDist import Controller
  from Bio.PopGen.FDist.Utils import convert_genepop_to_fdist
  
  gp_rec = GenePop.parse(open("example.gen"))
  fd_rec = convert_genepop_to_fdist(gp_rec)
  in_file = open("infile", "w")
  in_file.write(str(fd_rec))
  in_file.close()
>>
  
  In this code we simply parse a GenePop file and convert it to a FDist
record.
  Printing an FDist record will generate a string that can be directly
saved to a file and supplied to FDist. FDist requires the input file to
be called infile, therefore we save the record on a file with that name.
  The most important fields on a FDist record are: num_pops, the number
of populations; num_loci, the number of loci and loci_data with the
marker data itself. Most probably the details of the record are of no
interest to the user, as the record only purpose is to be passed to
FDist.
  The next step is to calculate the average F_st of the dataset (along
with the sample size):
<<ctrl = Controller.FDistController()
  fst, samp_size = ctrl.run_datacal()
>>
  
  On the first line we create an object to control the call of FDist
suite, this object will be used further on in order to call other suite
applications.
  On the second line we call the datacal application which computes the
average F_st and the sample size. It is worth noting that the F_st
computed by datacal is a variation of Weir and Cockerham's theta.
  We can now call the main fdist application in order to simulate
neutral markers.
<<sim_fst = ctrl.run_fdist(npops = 15, nsamples = fd_rec.num_pops, fst =
fst,
      sample_size = samp_size, mut = 0, num_sims = 40000)
>>
  
  
  
 npops  Number of populations existing in nature. This is really a
   "guestimate". Has to be lower than 100. 
 nsamples  Number of populations sampled, has to be lower than npops. 
 fst  Average F_st. 
 sample_size  Average number of individuals sampled on each population. 
 mut  Mutation model: 0 - Infinite alleles; 1 - Stepwise mutations 
 num_sims  Number of simulations to perform. Typically a number around
   40000 will be OK, but if you get a confidence interval that looks
   sharp (this can be detected when plotting the confidence interval
   computed below) the value can be increased (a suggestion would be
   steps of 10000 simulations). 
  
  The confusion in wording between number of samples and sample size
stems from the original application.
  A file named out.dat will be created with the simulated
heterozygosities and F_sts, it will have as many lines as the number of
simulations requested.
  Note that fdist returns the average F_st that it was capable of
simulating, for more details about this issue please read below the
paragraph on approximating the desired average F_st.
  The next (optional) step is to calculate the confidence interval:
<<cpl_interval = ctrl.run_cplot(ci=0.99)
>>
  
  You can only call cplot after having run fdist.
  This will calculate the confidence intervals (99% in this case) for a
previous fdist run. A list of quadruples is returned. The first element
represents the heterozygosity, the second the lower bound of F_st
confidence interval for that heterozygosity, the third the average and
the fourth the upper bound. This can be used to trace the confidence
interval contour. This list is also written to a file, out.cpl.
  The main purpose of this step is return a set of points which can be
easily used to plot a confidence interval. It can be skipped if the
objective is only to assess the status of each marker against the
simulation, which is the next step...
<<pv_data = ctrl.run_pv()
>>
  
  You can only call cplot after having run datacal and fdist.
  This will use the simulated markers to assess the status of each
individual real marker. A list, in the same order than the loci_list
that is on the FDist record (which is in the same order that the GenePop
record) is returned. Each element in the list is a quadruple, the
fundamental member of each quadruple is the last element (regarding the
other elements, please refer to the pv documentation -- for the sake of
simplicity we will not discuss them here) which returns the probability
of the simulated F_st being lower than the marker F_st. Higher values
would indicate a stronger candidate for positive selection, lower values
a candidate for balancing selection, and intermediate values a possible
neutral marker. What is "higher", "lower" or "intermediate" is really a
subjective issue, but taking a "confidence interval" approach and
considering a 95% confidence interval, "higher" would be between 0.95
and 1.0, "lower" between 0.0 and 0.05 and "intermediate" between 0.05
and 0.95.
9.8.3.1.1  Approximating the desired average F_st
  
  Fdist tries to approximate the desired average F_st by doing a
coalescent simulation using migration rates based on the formula
                                  1 - F   
                                          
                             N         st 
                                = ------- 
                              m    4F     
                                          
                                     st   
  
  This formula assumes a few premises like an infinite number of
populations.
  In practice, when the number of populations is low, the mutation model
is stepwise and the sample size increases, fdist will not be able to
simulate an acceptable approximate average F_st.
  To address that, a function is provided to iteratively approach the
desired value by running several fdists in sequence. This approach is
computationally more intensive than running a single fdist run, but
yields good results. The following code runs fdist approximating the
desired F_st:
<<sim_fst = ctrl.run_fdist_force_fst(npops = 15, nsamples =
fd_rec.num_pops,
      fst = fst, sample_size = samp_size, mut = 0, num_sims = 40000,
      limit = 0.05)
>>
  
  The only new optional parameter, when comparing with run_fdist, is
limit which is the desired maximum error. run_fdist can (and probably
should) be safely replaced with run_fdist_force_fst.
9.8.3.1.2  Final notes
  
  The process to determine the average F_st can be more sophisticated
than the one presented here. For more information we refer you to the
FDist README file. Biopython's code can be used to implement more
sophisticated approaches.
  

9.8.4  Future Developments
==========================
  
  The most desired future developments would be the ones you add
yourself ;) .
  That being said, already existing fully functional code is currently
being incorporated in Bio.PopGen, that code covers the applications
FDist and SimCoal2, the HapMap and UCSC Table Browser databases and some
simple statistics like F_st, or allele counts.
  

9.9  InterPro
*=*=*=*=*=*=*

  
  The 'Bio.InterPro' module works with files from the InterPro database,
which can be obtained from the InterPro project:
http://www.ebi.ac.uk/interpro/.
  The 'Bio.InterPro.Record' contains all the information stored in an
InterPro record. Its string representation also is a valid InterPro
record, but it is NOT guaranteed to be equivalent to the record from
which it was produced.
  The 'Bio.InterPro.Record' contains:
  
  
   - 'Database' 
   - 'Accession' 
   - 'Name' 
   - 'Dates' 
   - 'Type' 
   - 'Parent' 
   - 'Process' 
   - 'Function' 
   - 'Component' 
   - 'Signatures' 
   - 'Abstract' 
   - 'Examples' 
   - 'References' 
   - 'Database links' 
  
-----------------------------------
  
  
 (1) ftp://ftp.ncbi.nlm.nih.gov/genbank/genomes/Bacteria/Nanoarchaeum_eq
   uitans/AE017199.gbk
 
 (2) http://biopython.org/SRC/biopython/Tests/GenBank/cor6_6.gb
 
 (3) examples/opuntia.fasta
 
 (4) http://biopython.org/DIST/docs/tutorial/examples/opuntia.fasta
 
 (5) examples/protein.aln
 
 (6) http://biopython.org/DIST/docs/tutorial/examples/protein.aln
 
 (7) http://www.biosql.org/
 
 (8) http://open-bio.org/
  

Chapter 10    Advanced
**********************
   
  

10.1  The SeqRecord and SeqFeature classes
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=

   
  You read all about the basic Biopython sequence class in Chapter 3,
which described how to do many useful things with just the sequence.
However, many times sequences have important additional properties
associated with them -- as you will have seen with the 'SeqRecord'
object in Chapter 4. This section described how Biopython handles these
higher level descriptions of a sequence.
  

10.1.1  Sequence ids and Descriptions -- dealing with SeqRecords
================================================================
  
  Immediately above the Sequence class is the Sequence Record class,
defined in the 'Bio.SeqRecord' module. This class allows higher level
features such as ids and features to be associated with the sequence,
and is used thoughout the sequence input/output interface 'Bio.SeqIO',
described in Chapter 4. The 'SeqRecord'class itself is very simple, and
offers the following information as attributes:
  
  
 seq  -- The sequence itself -- A 'Seq' object
 
 id  -- The primary id used to identify the sequence. In most cases this
   is something like an accession number.
 
 name  -- A "common" name/id for the sequence. In some cases this will
   be the same as the accession number, but it could also be a clone
   name. I think of this as being analagous to the LOCUS id in a GenBank
   record.
 
 description  -- A human readible description or expressive name for the
   sequence. This is similar to what follows the id information in a
   FASTA formatted entry.
 
 annotations  -- A dictionary of additional information about the
   sequence. The keys are the name of the information, and the
   information is contained in the value. This allows the addition of
   more "unstructed" information to the sequence.
 
 features  -- A list of 'SeqFeature' objects with more structured
   information about the features on a sequence. The structure of
   sequence features is described below in Section 10.1.2. 
  
  Using a 'SeqRecord' class is not very complicated, since all of the
information is stored as attributes of the class. Initializing the class
just involves passing a 'Seq' object to the 'SeqRecord':
<<>>> from Bio.Seq import Seq
  >>> simple_seq = Seq("GATC")
  >>> from Bio.SeqRecord import SeqRecord
  >>> simple_seq_r = SeqRecord(simple_seq)
>>
  
  Additionally, you can also pass the id, name and description to the
initialization function, but if not they will be set as strings
indicating they are unknown, and can be modified subsequently:
<<>>> simple_seq_r.id
  '<unknown id>'
  >>> simple_seq_r.id = 'AC12345'
  >>> simple_seq_r.description = 'My little made up sequence I wish I
could
  write a paper about and submit to GenBank'
  >>> print simple_seq_r.description
  My little made up sequence I wish I could write a paper about and
submit
  to GenBank
  >>> simple_seq_r.seq
  Seq('GATC', Alphabet())
>>
  
  Adding annotations is almost as easy, and just involves dealing
directly with the annotation dictionary:
<<>>> simple_seq_r.annotations['evidence'] = 'None. I just made it up.'
  >>> print simple_seq_r.annotations
  {'evidence': 'None. I just made it up.'}
>>
  
  That's just about all there is to it! Next, you may want to learn
about SeqFeatures, which offer an additional structured way to represent
information about a sequence.
  

10.1.2  Features and Annotations -- SeqFeatures
===============================================
   
  Sequence features are an essential part of describing a sequence. Once
you get beyond the sequence itself, you need some way to organize and
easily get at the more "abstract" information that is known about the
sequence. While it is probably impossible to develop a general sequence
feature class that will cover everything, the Biopython 'SeqFeature'
class attempts to encapsulate as much of the information about the
sequence as possible. The design is heavily based on the GenBank/EMBL
feature tables, so if you understand how they look, you'll probably have
an easier time grasping the structure of the Biopython classes.
  

10.1.2.1  SeqFeatures themselves
--------------------------------
  
  The first level of dealing with Sequence features is the 'SeqFeature'
class itself. This class has a number of attributes, so first we'll list
them and there general features, and then work through an example to
show how this applies to a real life example, a GenBank feature table.
The attributes of a SeqFeature are:
  
  
 location  -- The location of the 'SeqFeature' on the sequence that you
   are dealing with. The locations end-points may be fuzzy --
   section 10.1.2.2 has a lot more description on how to deal with
   descriptions.
 
 type  -- This is a textual description of the type of feature (for
   instance, this will be something like 'CDS' or 'gene').
 
 ref  -- A reference to a different sequence. Some times features may be
   "on" a particular sequence, but may need to refer to a different
   sequence, and this provides the reference (normally an accession
   number). A good example of this is a genomic sequence that has most
   of a coding sequence, but one of the exons is on a different
   accession. In this case, the feature would need to refer to this
   different accession for this missing exon.
 
 ref_db  -- This works along with 'ref' to provide a cross sequence
   reference. If there is a reference, 'ref_db' will be set as None if
   the reference is in the same database, and will be set to the name of
   the database otherwise.
 
 strand  -- The strand on the sequence that the feature is located on.
   This may either be '1' for the top strand, '-1' for the bottom
   strand, or '0' for both strands (or if it doesn't matter). Keep in
   mind that this only really makes sense for double stranded DNA, and
   not for proteins or RNA.
 
 qualifiers  -- This is a python dictionary of additional information
   about the feature. The key is some kind of terse one-word description
   of what the information contained in the value is about, and the
   value is the actual information. For example, a common key for a
   qualifier might be "evidence" and the value might be "computational
   (non-experimental)." This is just a way to let the person who is
   looking at the feature know that it has not be experimentally
   (i. e. in a wet lab) confirmed.
 
 sub_features  -- A very important feature of a feature is that it can
   have additional 'sub_features' underneath it. This allows nesting of
   features, and helps us to deal with things such as the GenBank/EMBL
   feature lines in a (we hope) intuitive way. 
  
  To show an example of SeqFeatures in action, let's take a look at the
following feature from a GenBank feature table:
<<     mRNA            complement(join(<49223..49300,49780..>50208))
                       /gene="F28B23.12"
>>
  
  To look at the easiest attributes of the SeqFeature first, if you got
a SeqFeature object for this it would have it 'type' of 'mRNA', a
'strand' of -1 (due to the 'complement'), and would have None for the
'ref' and 'ref_db' since there are no references to external databases.
The 'qualifiers' for this SeqFeature would be a python dictionarary that
looked like '{'gene' : 'F28B23.12'}'.
  Now let's look at the more tricky part, how the 'join' in the location
line is handled. First, the location for the top level SeqFeature (the
one we are dealing with right now) is set as going from ''<49223' to
'>50208'' (see section 10.1.2.2 for the nitty gritty on how fuzzy
locations like this are handled). So the location of the top level
object is the entire span of the feature. So, how do you get at the
information in the 'join?' Well, that's where the 'sub_features' go in.
  The 'sub_features' attribute will have a list with two SeqFeature
objects in it, and these contain the information in the join. Let's look
at 'top_level_feature.sub_features[0]'; the first 'sub_feature'). This
object is a SeqFeature object with a 'type' of ''mRNA_join',' a 'strand'
of -1 (inherited from the parent SeqFeature) and a location going from
''<49223' to '49300''.
  So, the 'sub_features' allow you to get at the internal information if
you want it (i. e. if you were trying to get only the exons out of a
genomic sequence), or just to deal with the broad picture (i. e. you
just want to know that the coding sequence for a gene lies in a region).
Hopefully this structuring makes it easy and intuitive to get at the
sometimes complex information that can be contained in a SeqFeature.
  

10.1.2.2  Locations
-------------------
   
  In the section on SeqFeatures above, we skipped over one of the more
difficult parts of Features, dealing with the locations. The reason this
can be difficult is because of fuzziness of the positions in locations.
Before we get into all of this, let's just define the vocabulary we'll
use to talk about this. Basically there are two terms we'll use:
  
  
 position  -- This refers to a single position on a sequence, which may
   be fuzzy or not. For instance, 5, 20, '<100' and '3^5' are all
   positions.
 
 location  -- A location is two positions that defines a region of a
   sequence. For instance 5..20 (i. e. 5 to 20) is a location. 
  
  I just mention this because sometimes I get confused between the two.
  The complication in dealing with locations comes in the positions
themselves. In biology many times things aren't entirely certain (as
much as us wet lab biologists try to make them certain!). For instance,
you might do a dinucleotide priming experiment and discover that the
start of mRNA transcript starts at one of two sites. This is very useful
information, but the complication comes in how to represent this as a
position. To help us deal with this, we have the concept of fuzzy
positions. Basically there are five types of fuzzy positions, so we have
five classes do deal with them:
  
  
 ExactPosition  -- As its name suggests, this class represents a
   position which is specified as exact along the sequence. This is
   represented as just a a number, and you can get the position by
   looking at the 'position' attribute of the object.
 
 BeforePosition  -- This class represents a fuzzy position that occurs
   prior to some specified site. In GenBank/EMBL notation, this is
   represented as something like ''<13'', signifying that the real
   position is located somewhere less then 13. To get the specified
   upper boundary, look at the 'position' attribute of the object.
 
 AfterPosition  -- Contrary to 'BeforePosition', this class represents a
   position that occurs after some specified site. This is represented
   in GenBank as ''>13'', and like 'BeforePosition', you get the
   boundary number by looking at the 'position' attribute of the object.
 
 WithinPosition  -- This class models a position which occurs somewhere
   between two specified nucleotides. In GenBank/EMBL notation, this
   would be represented as '(1.5)', to represent that the position is
   somewhere within the range 1 to 5. To get the information in this
   class you have to look at two attributes. The 'position' attribute
   specifies the lower boundary of the range we are looking at, so in
   our example case this would be one. The 'extension' attribute
   specifies the range to the higher boundary, so in this case it would
   be 4. So 'object.position' is the lower boundary and 'object.position
   + object.extension' is the upper boundary.
 
 BetweenPosition  -- This class deals with a position that occurs
   between two coordinates. For instance, you might have a protein
   binding site that occurs between two nucleotides on a sequence. This
   is represented as ''2^3'', which indicates that the real position
   happens between position 2 and 3. Getting this information from the
   object is very similar to 'WithinPosition', the 'position' attribute
   specifies the lower boundary (2, in this case) and the 'extension'
   indicates the range to the higher boundary (1 in this case). 
  
  Now that we've got all of the types of fuzzy positions we can have
taken care of, we are ready to actually specify a location on a
sequence. This is handled by the 'FeatureLocation' class. An object of
this type basically just holds the potentially fuzzy start and end
positions of a feature. You can create a 'FeatureLocation' object by
creating the positions and passing them in:
<<>>> from Bio import SeqFeature
  >>> start_pos = SeqFeature.AfterPosition(5)
  >>> end_pos = SeqFeature.BetweenPosition(8, 1)
  >>> my_location = SeqFeature.FeatureLocation(start_pos, end_pos)
>>
  
  If you print out a 'FeatureLocation' object, you can get a nice
representation of the information:
<<>>> print my_location
  [>5:(8^9)]
>>
  
  We can access the fuzzy start and end positions using the start and
end attributes of the location:
<<>>> my_location.start
  <Bio.SeqFeature.AfterPosition instance at 0x101d7164>
  >>> print my_location.start
  >5
  >>> print my_location.end
  (8^9)
>>
  
  If you don't want to deal with fuzzy positions and just want numbers,
you just need to ask for the 'nofuzzy_start' and 'nofuzzy_end'
attributes of the location:
<<>>> my_location.nofuzzy_start
  5
  >>> my_location.nofuzzy_end
  8
>>
  
  Notice that this just gives you back the position attributes of the
fuzzy locations.
  Similary, to make it easy to create a position without worrying about
fuzzy positions, you can just pass in numbers to the 'FeaturePosition'
constructors, and you'll get back out 'ExactPosition' objects:
<<>>> exact_location = SeqFeature.FeatureLocation(5, 8)
  >>> print exact_location
  [5:8]
  >>> exact_location.start
  <Bio.SeqFeature.ExactPosition instance at 0x101dcab4>
>>
  
  That is all of the nitty gritty about dealing with fuzzy positions in
Biopython. It has been designed so that dealing with fuzziness is not
that much more complicated than dealing with exact positions, and
hopefully you find that true!
  

10.1.2.3  References
--------------------
  
  Another common annotation related to a sequence is a reference to a
journal or other published work dealing with the sequence. We have a
fairly simple way of representing a Reference in Biopython -- we have a
'Bio.SeqFeature.Reference' class that stores the relevant information
about a reference as attributes of an object.
  The attributes include things that you would expect to see in a
reference like 'journal', 'title' and 'authors'. Additionally, it also
can hold the 'medline_id' and 'pubmed_id' and a 'comment' about the
reference. These are all accessed simply as attributes of the object.
  A reference also has a 'location' object so that it can specify a
particular location on the sequence that the reference refers to. For
instance, you might have a journal that is dealing with a particular
gene located on a BAC, and want to specify that it only refers to this
position exactly. The 'location' is a potentially fuzzy location, as
described in section 10.1.2.2.
  That's all there is too it. References are meant to be easy to deal
with, and hopefully general enough to cover lots of usage cases.
  

10.2  Regression Testing Framework
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=

   
  Biopython has a regression testing framework originally written by
Andrew Dalke and ported to PyUnit by Brad Chapman which helps us make
sure the code is as bug-free as possible before going out.
  

10.2.1  Writing a Regression Test
=================================
  
  Every module that goes into Biopython should have a test (and should
also have documentation!). Let's say you've written a new module called
Biospam -- here is what you should do to make a regression test:
  
  
   1. Write a script called 'test_Biospam.py'
 
    
    
      - This script should live in the Tests directory
    
      - The script should test all of the important functionality of the
      module (the more you test the better your test is, of course!).
    
      - Try to avoid anything which might be platform specific, such as
      printing floating point numbers without using an explicit
      formatting string. 
 
 
   2. If the script requires files to do the testing, these should go in
   the directory Tests/Biospam.
 
   3. Write out the test output and verify the output to be correct.
   There are two ways to do this:
 
     
      1. The long way:
    
       
       
         - Run the script and write its output to a file. On UNIX
         machines, you would do something like: 'python test_Biospam.py
         > test_Biospam' which would write the output to the file
         'test_Biospam'.
       
         - Manually look at the file 'test_Biospam' to make sure the
         output is correct. When you are sure it is all right and there
         are no bugs, you need to quickly edit the 'test_Biospam' file
         so that the first line is: `'test_Biospam'' (no quotes).
       
         - copy the 'test_Biospam' file to the directory Tests/output
    
    
      2. The quick way:
    
        
         - Run 'python run_tests.py -g test_Biospam.py'. The regression
         testing framework is nifty enough that it'll put the output in
         the right place in just the way it likes it. 
       
         - Go to the output (which should be in
         'Tests/output/test_Biospam') and double check the output to
         make sure it is all correct.
    
 
 
   4. Now change to the Tests directory and run the regression tests
   with 'python run_tests.py'. This will run all of the tests, and you
   should see your test run (and pass!).
 
   5. That's it! Now you've got a nice test for your module ready to
   check into CVS. Congratulations! 
  
  

10.3  Parser Design
*=*=*=*=*=*=*=*=*=*

  
  Many of the older Biopython parsers were built around an
event-oriented design that includes Scanner and Consumer objects.
  Scanners take input from a data source and analyze it line by line,
sending off an event whenever it recognizes some information in the
data. For example, if the data includes information about an organism
name, the scanner may generate an 'organism_name' event whenever it
encounters a line containing the name.
  Consumers are objects that receive the events generated by Scanners.
Following the previous example, the consumer receives the
'organism_name' event, and the processes it in whatever manner necessary
in the current application.
  This is a very flexible framework, which is advantageous if you want
to be able to parse a file format into more than one representation. For
example, both the 'Bio.GenBank' and 'Bio.SwissProt' modules use this to
read their file formats as both generic 'SeqRecord' objects and
file-format-specific record objects.
  More recently, many of the parsers added for 'Bio.SeqIO' and
'Bio.AlignIO' take a much simpler approach, but only generate a single
object representation ('SeqRecord' and 'Alignment' objects
respectively).
  

10.4  Substitution Matrices
*=*=*=*=*=*=*=*=*=*=*=*=*=*

  
  

10.4.1  SubsMat
===============
  
  This module provides a class and a few routines for generating
substitution matrices, similar to BLOSUM or PAM matrices, but based on
user-provided data.
  Additionally, you may select a matrix from MatrixInfo.py, a collection
of established substitution matrices.
<<class SeqMat(UserDict.UserDict)
>>
  
  
  
   1. Attributes
 
     
      1. 'self.data': a dictionary in the form of '{(i1,j1):n1,
      (i1,j2):n2,...,(ik,jk):nk}' where i, j are alphabet letters, and n
      is a value.
    
      2. 'self.alphabet': a class as defined in Bio.Alphabet
    
      3. 'self.ab_list': a list of the alphabet's letters, sorted.
      Needed mainly for internal purposes
    
      4. 'self.sum_letters': a dictionary. '{i1: s1, i2: s2,...,in:sn}'
      where: 
        
         1. i: an alphabet letter; 
         2. s: sum of all values in a half-matrix for that letter; 
         3. n: number of letters in alphabet. 
     
 
 
   2. Methods
 
    
    
      1. 
      <<__init__(self,data=None,alphabet=None,
                 mat_type=NOTYPE,mat_name='',build_later=0):
      >>
    
    
       
       
         1. 'data': can be either a dictionary, or another SeqMat
         instance. 
         2. 'alphabet': a Bio.Alphabet instance. If not provided,
         construct an alphabet from data.
       
         3. 'mat_type': type of matrix generated. One of the following:
       
           
          NOTYPE  No type defined 
          ACCREP  Accepted Replacements Matrix 
          OBSFREQ  Observed Frequency Matrix 
          EXPFREQ  Expsected Frequency Matrix 
          SUBS  Substitution Matrix  
          LO  Log Odds Matrix 
       
       'mat_type' is provided automatically by some of SubsMat's
         functions.
       
         4. 'mat_name': matrix name, such as "BLOSUM62" or "PAM250"
       
         5. 'build_later': default false. If true, user may supply only
         alphabet and empty dictionary, if intending to build the matrix
         later. this skips the sanity check of alphabet size vs. matrix
         size.
    
    
      2. 
      <<entropy(self,obs_freq_mat)
      >>
    
    
        
         1. 'obs_freq_mat': an observed frequency matrix. Returns the
         matrix's entropy, based on the frequency in 'obs_freq_mat'. The
         matrix instance should be LO or SUBS. 
    
    
      3. 
      <<letter_sum(self,letter)
      >>
    
    Returns the sum of all values in the matrix, for the provided
      'letter'
    
      4. 
      <<all_letters_sum(self)
      >>
    
    Fills the dictionary attribute 'self.sum_letters' with the sum of
      values for each letter in the matrix's alphabet.
    
      5. 
      <<print_mat(self,f,format="%4d",bottomformat="%4s",alphabet=None)
      >>
    
    prints the matrix to file handle f. 'format' is the format field for
      the matrix values; 'bottomformat' is the format field for the
      bottom row, containing matrix letters. Example output for a
      3-letter alphabet matrix:
      <<A 23
        B 12 34
        C 7  22  27
          A   B   C
      >>
    
    The 'alphabet' optional argument is a string of all characters in
      the alphabet. If supplied, the order of letters along the axes is
      taken from the string, rather than by alphabetical order.
 
 
   3. Usage
 The following section is layed out in the order by which most people
   wish to generate a log-odds matrix. Of course, interim matrices can
   be generated and investigated. Most people just want a log-odds
   matrix, that's all.
 
    
    
      1. Generating an Accepted Replacement Matrix
    Initially, you should generate an accepted replacement matrix (ARM)
      from your data. The values in ARM are the counted number of
      replacements according to your data. The data could be a set of
      pairs or multiple alignments. So for instance if Alanine was
      replaced by Cysteine 10 times, and Cysteine by Alanine 12 times,
      the corresponding ARM entries would be:
      <<('A','C'): 10, ('C','A'): 12
      >>
    
    as order doesn't matter, user can already provide only one entry:
      <<('A','C'): 22
      >>
    
    A SeqMat instance may be initialized with either a full (first
      method of counting: 10, 12) or half (the latter method, 22)
      matrices. A full protein alphabet matrix would be of the size
      20x20 = 400. A half matrix of that alphabet would be 20x20/2 +
      20/2 = 210. That is because same-letter entries don't change. (The
      matrix diagonal). Given an alphabet size of N:
    
        
         1. Full matrix size:N*N
       
         2. Half matrix size: N(N+1)/2 
    
    The SeqMat constructor automatically generates a half-matrix, if a
      full matrix is passed. If a half matrix is passed, letters in the
      key should be provided in alphabetical order: ('A','C') and not
      ('C',A').
    At this point, if all you wish to do is generate a log-odds matrix,
      please go to the section titled Example of Use. The following text
      describes the nitty-gritty of internal functions, to be used by
      people who wish to investigate their nucleotide/amino-acid
      frequency data more thoroughly.
    
      2. Generating the observed frequency matrix (OFM)
    Use: 
      <<OFM = SubsMat._build_obs_freq_mat(ARM)
      >>
    
    The OFM is generated from the ARM, only instead of replacement
      counts, it contains replacement frequencies.
    
      3. Generating an expected frequency matrix (EFM)
    Use:
      <<EFM = SubsMat._build_exp_freq_mat(OFM,exp_freq_table)
      >>
    
    
        
         1. 'exp_freq_table': should be a FreqTable instance. See
         section 10.4.2 for detailed information on FreqTable. Briefly,
         the expected frequency table has the frequencies of appearance
         for each member of the alphabet. It is implemented as a
         dictionary with the alphabet letters as keys, and each letter's
         frequency as a value. Values sum to 1. 
    
    The expected frequency table can (and generally should) be generated
      from the observed frequency matrix. So in most cases you will
      generate 'exp_freq_table' using:
      <<>>> exp_freq_table = SubsMat._exp_freq_table_from_obs_freq(OFM)
        >>> EFM = SubsMat._build_exp_freq_mat(OFM,exp_freq_table)
      >>
    
    But you can supply your own 'exp_freq_table', if you wish
    
      4. Generating a substitution frequency matrix (SFM)
    Use:
      <<SFM = SubsMat._build_subs_mat(OFM,EFM)
      >>
    
    Accepts an OFM, EFM. Provides the division product of the
      corresponding values.
    
      5. Generating a log-odds matrix (LOM)
    Use: 
      <<LOM=SubsMat._build_log_odds_mat(SFM[,logbase=10,factor=10.0,roun
      d_digit=1])
      >>
    
    
        
         1. Accepts an SFM.
       
         2. 'logbase': base of the logarithm used to generate the
         log-odds values.
       
         3. 'factor': factor used to multiply the log-odds values. Each
         entry is generated by log(LOM[key])*factor And rounded to the
         'round_digit' place after the decimal point, if required.
    
 
 
   4. Example of use
 As most people would want to generate a log-odds matrix, with minimum
   hassle, SubsMat provides one function which does it all:
   <<make_log_odds_matrix(acc_rep_mat,exp_freq_table=None,logbase=10,
                           factor=10.0,round_digit=0):
   >>
 
 
     
      1. 'acc_rep_mat': user provided accepted replacements matrix 
      2. 'exp_freq_table': expected frequencies table. Used if provided,
      if not, generated from the 'acc_rep_mat'. 
      3. 'logbase': base of logarithm for the log-odds matrix. Default
      base 10. 
      4. 'round_digit': number after decimal digit to which result
      should be rounded. Default zero. 
 
  
  

10.4.2  FreqTable
=================
   
<<FreqTable.FreqTable(UserDict.UserDict)
>>
  
  
 
 
   1. Attributes:
 
     
      1. 'alphabet': A Bio.Alphabet instance. 
      2. 'data': frequency dictionary 
      3. 'count': count dictionary (in case counts are provided). 
 
 
   2. Functions: 
     
      1. 'read_count(f)': read a count file from stream f. Then convert
      to frequencies 
      2. 'read_freq(f)': read a frequency data file from stream f. Of
      course, we then don't have the counts, but it is usually the
      letter frquencies which are interesting. 
 
 
   3. Example of use: The expected count of the residues in the database
   is sitting in a file, whitespace delimited, in the following format
   (example given for a 3-letter alphabet):
   <<A   35
     B   65
     C   100
   >>
 
 And will be read using the 'FreqTable.read_count(file_handle)'
   function.
 An equivalent frequency file:
   <<A  0.175
     B  0.325
     C  0.5
   >>
 
 Conversely, the residue frequencies or counts can be passed as a
   dictionary. Example of a count dictionary (3-letter alphabet):
   <<{'A': 35, 'B': 65, 'C': 100}
   >>
 
 Which means that an expected data count would give a 0.5 frequency for
   'C', a 0.325 probability of 'B' and a 0.175 probability of 'A' out of
   200 total, sum of A, B and C)
 A frequency dictionary for the same data would be:
   <<{'A': 0.175, 'B': 0.325, 'C': 0.5}
   >>
 
 Summing up to 1.
 When passing a dictionary as an argument, you should indicate whether
   it is a count or a frequency dictionary. Therefore the FreqTable
   class constructor requires two arguments: the dictionary itself, and
   FreqTable.COUNT or FreqTable.FREQ indicating counts or frequencies,
   respectively.
 Read expected counts. readCount will already generate the frequencies
   Any one of the following may be done to geerate the frequency table
   (ftab):
   <<>>> from SubsMat import *
     >>> ftab =
   FreqTable.FreqTable(my_frequency_dictionary,FreqTable.FREQ)
     >>> ftab = FreqTable.FreqTable(my_count_dictionary,FreqTable.COUNT)
     >>> ftab = FreqTable.read_count(open('myCountFile'))
     >>> ftab = FreqTable.read_frequency(open('myFrequencyFile'))
   >>
 
  
  

Chapter 11    Where to go from here -- contributing to Biopython
****************************************************************
  
  

11.1  Maintaining a distribution for a platform
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*

   
  We try to release Biopython to make it as easy to install as possible
for users. Thus, we try to provide the Biopython libraries in as many
install formats as we can. Doing this from release to release can be a
lot of work for developers, and sometimes requires them to maintain
packages they are not all that familiar with. This section is meant to
provide tips to encourage other people besides developers to maintain
platform builds.
  In general, this is fairly easy -- all you would need to do is produce
the system specific package whenever we make a release. You should then
check the package (of course!) to make sure it installs everything
properly. Then you just send it to one of the main developers, they
stick the package on the web site and just like that, you've contributed
to Biopython! Snazzy.
  Below are some tips for certain platforms to maybe get people started
with helping out:
  
  
 RPMs  -- RPMs are pretty popular package systems on some platforms.
   There is lots of documentation on RPMs available at
   http://www.rpm.org to help you get started with them. To create an
   RPM for your platform is really easy. You just need to be able to
   build the package from source (having a C compiler that works is thus
   essential) -- see the Biopython installation instructions for more
   info on this.
 To make the RPM, you just need to do:
   <<python setup.py bdist_rpm
   >>
 
 This will create an RPM for your specific platform and a source RPM in
   the directory 'dist'. This RPM should be good and ready to go, so
   this is all you need to do! Nice and easy.
 
 Windows  -- Windows products typically have a nice graphical installer
   that installs all of the essential components in the right place. We
   can use Distutils to create a installer of this type fairly easily.
 You must first make sure you have a C compiler on your Windows
   computer, and that you can compile and install things (see the
   Biopython installation instructions for info on how to do this).
 Once you are setup with a C compiler, making the installer just
   requires doing:
   <<python setup.py bdist_wininst
   >>
 
 Now you've got a Windows installer. Congrats!
 
 Macintosh  -- We would love to find someone who wants to maintain a
   Macintosh distribution, and make it available in a Macintosh friendly
   format like bin-hex. This would basically include finding a way to
   compile everything on the Mac, making sure all of the code written by
   us UNIX-based developers works well on the Mac, and providing any
   Mac-friendly hints for us.
  
  Once you've got a package, please test it on your system to make sure
it installs everything in a good way and seems to work properly. Once
you feel good about it, send it off to one of the biopython developers
(write to our main list serve at biopython@biopython.org if you're not
sure who to send it to) and you've done it. Thanks!
  

11.2  Bug Reports + Feature Requests
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=

  
  Getting feedback on the Biopython modules is very important to us.
Open-source projects like this benefit greatly from feedback,
bug-reports (and patches!) from a wide variety of contributors.
  The main forums for discussing feature requests and potential bugs are
the biopython development lists:
  
  
   - biopython@biopython.org -- An unmoderated list for discussion of
   anything to do with biopython.
 
   - biopython-dev@biopython.org -- A more development oriented list
   that is mainly used by developers (but anyone is free to
   contribute!). 
  
  Additionally, if you think you've found a bug, you can submit it to
our bug-tracking page at http://bugzilla.open-bio.org/. This way, it
won't get buried in anyone's Inbox and forgotten about.
  

11.3  Contributing Code
*=*=*=*=*=*=*=*=*=*=*=*

  
  There are no barriers to joining biopython code development other than
an interest in creating biology-related code in python. The best place
to express an interest is on the biopython mailing lists -- just let us
know you are interested in coding and what kind of stuff you want to
work on. Normally, we try to have some discussion on modules before
coding them, since that helps generate good ideas -- then just feel free
to jump right in and start coding!
  The main biopython release tries to be fairly uniform and
interworkable, to make it easier for users. You can read about some of
(fairly informal) coding style guidelines we try to use in biopython in
the contributing documentation at
http://biopython.org/wiki/Contributing. We also try to add code to the
distribution along with tests (see section 10.2 for more info on the
regression testing framework) and documentation, so that everything can
stay as workable and well documented as possible. This is, of course,
the most ideal situation, under many situations you'll be able to find
other people on the list who will be willing to help add documentation
or more tests for your code once you make it available. So, to end this
paragraph like the last, feel free to start working!
  Additionally, if you have code that you don't think fits in the
distribution, but that you want to make available, we maintain Script
Central (http://biopython.org/wiki/Scriptcentral) which has pointers to
freely available code in python for bioinformatics.
  Hopefully this documentation has got you excited enough about
biopython to try it out (and most importantly, contribute!). Thanks for
reading all the way through!
  

Chapter 12    Appendix: Useful stuff about Python
*************************************************
   
  If you haven't spent a lot of time programming in python, many
questions and problems that come up in using Biopython are often related
to python itself. This section tries to present some ideas and code that
come up often (at least for us!) while using the Biopython libraries. If
you have any suggestions for useful pointers that could go here, please
contribute!
  

12.1  What the heck is a handle?
*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=*=

   
  Handles are mentioned quite frequently throughout this documentation,
and are also fairly confusing (at least to me!). Basically, you can
think of a handle as being a "wrapper" around text information.
  Handles provide (at least) two benefits over plain text information:
  
  
   1. They provide a standard way to deal with information stored in
   different ways. The text information can be in a file, or in a string
   stored in memory, or the output from a command line program, or at
   some remote website, but the handle provides a common way of dealing
   with information in all of these formats.
 
   2. They allow text information to be read incrementally, instead of
   all at once. This is really important when you are dealing with huge
   text files which would use up all of your memory if you had to load
   them all. 
  
  Handles can deal with text information that is being read
(e. g. reading from a file) or written (e. g. writing information to a
file). In the case of a "read" handle, commonly used functions are
'read()', which reads the entire text information from the handle, and
'readline()', which reads information one line at a time. For "write"
handles, the function 'write()' is regularly used.
  The most common usage for handles is reading information from a file,
which is done using the built-in python function 'open'. Here, we open a
handle to the file m_cold.fasta (1) (also available online here (2)):
<<>>> handle = open("m_cold.fasta", "r")
  >>> handle.readline()
  ">gi|8332116|gb|BE037100.1|BE037100 MP14H09 MP Mesembryanthemum ...\n"
>>
  
  Handles are regularly used in Biopython for passing information to
parsers.
  

12.1.1  Creating a handle from a string
=======================================
  
  One useful thing is to be able to turn information contained in a
string into a handle. The following example shows how to do this using
'cStringIO' from the Python standard library:
<<>>> my_info = 'A string\n with multiple lines.'
  >>> print my_info
  A string
   with multiple lines.
  >>> import cStringIO
  >>> my_info_handle = cStringIO.StringIO(my_info)
  >>> first_line = my_info_handle.readline()
  >>> print first_line
  A string
  
  >>> second_line = my_info_handle.readline()
  >>> print second_line
   with multiple lines.
>>
  
-----------------------------------------------------------------------
  
   This document was translated from LaTeX by HeVeA (3).
-----------------------------------
  
  
 (1) examples/m_cold.fasta
 
 (2) http://biopython.org/DIST/docs/tutorial/examples/m_cold.fasta
 
 (3) http://hevea.inria.fr/index.html
