Metadata-Version: 1.1
Name: biocommons.seqrepo
Version: 0.3.0a1
Summary: Python package for writing and reading a local collection of biological sequences.  The repository is non-redundant, compressed, and journalled, making it efficient to store and transfer incremental snapshots. 
Home-page: https://github.com/biocommons/biocommons.seqrepo
Author: biocommons.seqrepo Committers
Author-email: biocommons-dev@googlegroups.com
License: Apache License 2.0 (http://www.apache.org/licenses/LICENSE-2.0)
Description: biocommons.seqrepo
        !!!!!!!!!!!!!!!!!!
        
        Python package for writing and reading a local collection of
        biological sequences.  The repository is non-redundant, compressed,
        and journalled, making it efficient to store and transfer multiple
        snapshots.
        
        Released under the Apache License, 2.0.
        
        |ci_rel| |pypi_rel|
        
        
        Features
        !!!!!!!!
        
        * Timestamped snapshots of read-only sequence repository
        * Space-efficient storage of sequences within a single snapshot and
          across snapshots
        * Bandwidth-efficient transfer incremental updates
        * Fast fetching of sequence slices on chromosome-scale sequences
        * Precomputed digests that may be used as sequence aliases
        * Mappings of external aliases (i.e., accessions or identifiers like
          NM_013305.4) to sequences
        
        The above features are achieved by storing sequences non-redundantly
        and compressed, using an add-only journalled filesystem structure
        within a single snapshot, and by using hard links across snapshots.
        Each sequence is associated with a namespaced alias such as
        ``<seguid,rvvuhY0FxFLNwf10FXFIrSQ7AvQ>``, ``<ncbi,NP_004009.1>``,
        ``<gi,5032303>``, ``<ensembl-75ENSP00000354464>``,
        ``<ensembl-85,ENSP00000354464.4>`` (all of which refer to the same
        sequence).  Block gzipped format (`BGZF
        <https://samtools.github.io/hts-specs/SAMv1.pdf>`__)) enables pysam to
        provide fast random access to compressed sequences.
        
        For more information, see `<doc/design.rst>`__.
        
        
        Deployments Scenarios
        !!!!!!!!!!!!!!!!!!!!!
        * Available now: Local read-only archive, mirrored from public site,
          accessed via Python API (see `Mirroring documentation <doc/mirror.rst>`__)
        * Available now: Local read-write archive, maintained with command
          line utility and/or API (see `Command Line Interface documentation
          <doc/cli.rst>`__).
        * Planned: Docker-based data-only container that may be linked to application container
        * Planned: Docker image that provides REST interface for local or remote access
        
        
        Requirements
        !!!!!!!!!!!!
        
        Reading a sequence repository requires several packages, all of which
        are available from pypi. Installation should be as simple as `pip
        install biocommons.seqrepo`.
        
        Writing sequence files also requires ``bgzip``, which provided in the
        `htslib <https://github.com/samtools/htslib>`__ repo. Ubuntu users
        should install the ``tabix`` package with ``sudo apt install tabix``.
        
        Development and deployments are on Ubuntu. Other systems may work but
        are not tested.  Patches to get other systems working would be
        welcomed.
        
        
        Quick Start
        !!!!!!!!!!!
        
        On Ubuntu 16.04::
        
          $ sudo apt install -y python3-dev gcc zlib1g-dev tabix
          $ pip install seqrepo
          $ seqrepo pull -i 20160906 
          $ seqrepo show-status -i 20160906 
          seqrepo 0.2.3.post3.dev8+nb8298bd62283
          root directory: /usr/local/share/seqrepo/20160906, 7.9 GB
          backends: fastadir (schema 1), seqaliasdb (schema 1) 
          sequences: 773587 sequences, 93051609959 residues, 192 files
          aliases: 5579572 aliases, 5480085 current, 26 namespaces, 773587 sequences
          
          $ seqrepo start-shell -i 20160906
          In [1]: sr["NC_000001.11"][780000:780020]
          Out[1]: 'TGGTGGCACGCGCTTGTAGT'
          
          # N.B. The following output is edited
          $ seqrepo export -i 20160906 | head -n100
          >sha1:9a2acba3dd7603f... seguid:mirLo912A/MppLuS1cUyFMduLUQ ensembl-85:GENSCAN00000003538 sh:---7nAwbv5Fs2Ml2-k3X6Zvj-6ZcjeD3 ...
          MDSPLREDDSQTCARLWEAEVKRHSLEGLTVFGTAVQIHNVQRRAIRAKGTQEAQAELLCRGPRLLDRFLEDACILKEGRGTDTGQHCRGDARISSHLEA
          SGTHIQLLALFLVSSSDTPPSLLRFCHALEHDIRYNSSFDSYYPLSPHSRHNDDLQTPSSHLGYIITVPDPTLPLTFASLYLGMAPCTSMGSSSMGIFQS
          QRIHAFMKGKNKWDEYEGRKESWKIRSNSQTGEPTF
          >sha1:ca996b263102b1... seguid:yplrJjECsVqQufeYy0HkDD16z58 ncbi:XR_001733142.1 sh:---WkVUs3IT3_ZZM-ReDjypLo6d_vJx6 gi:1034683989
          TTTACGTCTTTCTGGGAATTTATACTGGAAGTATACTTACCTCTGTGCAAAATTGCAAATATATAAGGTAATTCATTCCAGCATTGCTTATATTAGGTTG
          AACTATGTAACATTGACATTGATGTGAATCAAAAATGGTTGAAGGCTGGCAGTTTCATATGATTCAGCCTATAATAGCAAAAGATTGAAAAAATCCATTA
          ATACAGTGTGGTTCAAAAAAATTTGTTGTATCAAGGTAAAATAATAGCCTGAATATAATTAAGATAGTCTGTGTATACATCGATGAAAACATTGCCAATA
        
        
        
        See `Installation <doc/installation.rst>`__ and `Mirroring
        <doc/mirror.rst>`__ for more information.
        
        
        
        .. |pypi_rel| image:: https://badge.fury.io/py/biocommons.seqrepo.png
          :target: https://pypi.org/pypi?name=biocommons.seqrepo
          :align: middle
        
        .. |ci_rel| image:: https://travis-ci.org/biocommons/biocommons.seqrepo.svg?branch=master
          :target: https://travis-ci.org/biocommons/biocommons.seqrepo
          :align: middle 
        
        
Keywords: bioinformatics
Platform: UNKNOWN
Classifier: Development Status :: 3 - Alpha
Classifier: Intended Audience :: Developers
Classifier: Intended Audience :: Healthcare Industry
Classifier: Intended Audience :: Science/Research
Classifier: License :: OSI Approved :: Apache Software License
Classifier: Operating System :: OS Independent
Classifier: Programming Language :: Python
Classifier: Programming Language :: Python :: 2
Classifier: Programming Language :: Python :: 3
Classifier: Topic :: Database :: Front-Ends
Classifier: Topic :: Scientific/Engineering :: Bio-Informatics
Classifier: Topic :: Scientific/Engineering :: Medical Science Apps.
