Metadata-Version: 1.1
Name: biocommons.seqrepo
Version: 0.3.5
Summary: Python package for writing and reading a local collection of biological sequences.  The repository is non-redundant, compressed, and journalled, making it efficient to store and transfer incremental snapshots. 
Home-page: https://github.com/biocommons/biocommons.seqrepo
Author: biocommons.seqrepo Committers
Author-email: biocommons-dev@googlegroups.com
License: Apache License 2.0 (http://www.apache.org/licenses/LICENSE-2.0)
Description: biocommons.seqrepo
        !!!!!!!!!!!!!!!!!!
        
        Python package for writing and reading a local collection of
        biological sequences.  The repository is non-redundant, compressed,
        and journalled, making it efficient to store and transfer multiple
        snapshots.
        
        Released under the Apache License, 2.0.
        
        |ci_rel| |pypi_rel|
        
        
        Features
        !!!!!!!!
        
        * Timestamped, read-only snapshots.
        * Space-efficient storage of sequences within a single snapshot and
          across snapshots.
        * Bandwidth-efficient transfer incremental updates.
        * Fast fetching of sequence slices on chromosome-scale sequences.
        * Precomputed digests that may be used as sequence aliases.
        * Mappings of external aliases (i.e., accessions or identifiers like
          NM_013305.4) to sequences.
        
        
        Deployments Scenarios
        !!!!!!!!!!!!!!!!!!!!!
        * Local read-only archive, mirrored from public site,
          accessed via Python API (see `Mirroring documentation <doc/mirror.rst>`__)
        * Local read-write archive, maintained with command
          line utility and/or API (see `Command Line Interface documentation
          <doc/cli.rst>`__).
        * Docker-based data-only container that may be linked to application container.
        * Planned: Docker image that provides REST interface for local or remote access
        
        
        Technical Quick Peek
        !!!!!!!!!!!!!!!!!!!!
        
        Within a single snapshot, sequences are stored *non-redundantly* and
        *compressed* in an add-only journalled filesystem structure.  A
        truncated SHA-512 hash is used to assess uniquness and as an
        internal id.  (The digest is truncated for space efficiency.)
        
        Sequences are compressed using the Block GZipped Format (`BGZF
        <https://samtools.github.io/hts-specs/SAMv1.pdf>`__)), which enables
        pysam to provide fast random access to compressed sequences. (Variable
        compression typically makes random access impossible.)
        
        Sequence files are immutable, thereby enabling the use of hardlinks
        across snapshots and eliminating redundant transfers (e.g., with
        rsync).
        
        Each sequence id is associated with a namespaced alias in a sqlite
        database.  Such as ``<seguid,rvvuhY0FxFLNwf10FXFIrSQ7AvQ>``,
        ``<NCBI,NP_004009.1>``, ``<gi,5032303>``,
        ``<ensembl-75ENSP00000354464>``, ``<ensembl-85,ENSP00000354464.4>``.
        The sqlite database is mutable across releases.
        
        For calibration, recent releases that include 3 human genome
        assemblies (including patches), and full RefSeq sets (NM, NR, NP, NT,
        XM, and XP) consumes approximately 8GB.  The minimum marginal size for
        additional snapshots is approximately 2GB (for the sqlite database,
        which is not hardlinked).
        
        For more information, see `<doc/design.rst>`__.
        
        
        
        Requirements
        !!!!!!!!!!!!
        
        Reading a sequence repository requires several packages, all of which
        are available from pypi. Installation should be as simple as `pip
        install biocommons.seqrepo`.
        
        Writing sequence files also requires ``bgzip``, which provided in the
        `htslib <https://github.com/samtools/htslib>`__ repo. Ubuntu users
        should install the ``tabix`` package with ``sudo apt install tabix``.
        
        Development and deployments are on Ubuntu. Other systems may work but
        are not tested.  Patches to get other systems working would be
        welcomed.
        
        
        Quick Start
        !!!!!!!!!!!
        
        On Ubuntu 16.04::
        
          $ sudo apt install -y python3-dev gcc zlib1g-dev tabix
          $ pip install seqrepo
          $ sudo mkdir /usr/local/share/seqrepo
          $ sudo chown $USER /usr/local/share/seqrepo
          $ seqrepo pull -i 20160906 
          $ seqrepo show-status -i 20160906 
          seqrepo 0.2.3.post3.dev8+nb8298bd62283
          root directory: /usr/local/share/seqrepo/20160906, 7.9 GB
          backends: fastadir (schema 1), seqaliasdb (schema 1) 
          sequences: 773587 sequences, 93051609959 residues, 192 files
          aliases: 5579572 aliases, 5480085 current, 26 namespaces, 773587 sequences
          
          $ seqrepo start-shell -i 20160906
          In [1]: sr["NC_000001.11"][780000:780020]
          Out[1]: 'TGGTGGCACGCGCTTGTAGT'
          
          # N.B. The following output is edited for simplicity
          $ seqrepo export -i 20160906 | head -n100
          >SHA1:9a2acba3dd7603f... SEGUID:mirLo912A/MppLuS1cUyFMduLUQ Ensembl-85:GENSCAN00000003538 ...
          MDSPLREDDSQTCARLWEAEVKRHSLEGLTVFGTAVQIHNVQRRAIRAKGTQEAQAELLCRGPRLLDRFLEDACILKEGRGTDTGQHCRGDARISSHLEA
          SGTHIQLLALFLVSSSDTPPSLLRFCHALEHDIRYNSSFDSYYPLSPHSRHNDDLQTPSSHLGYIITVPDPTLPLTFASLYLGMAPCTSMGSSSMGIFQS
          QRIHAFMKGKNKWDEYEGRKESWKIRSNSQTGEPTF
          >SHA1:ca996b263102b1... SEGUID:yplrJjECsVqQufeYy0HkDD16z58 NCBI:XR_001733142.1 gi:1034683989
          TTTACGTCTTTCTGGGAATTTATACTGGAAGTATACTTACCTCTGTGCAAAATTGCAAATATATAAGGTAATTCATTCCAGCATTGCTTATATTAGGTTG
          AACTATGTAACATTGACATTGATGTGAATCAAAAATGGTTGAAGGCTGGCAGTTTCATATGATTCAGCCTATAATAGCAAAAGATTGAAAAAATCCATTA
          ATACAGTGTGGTTCAAAAAAATTTGTTGTATCAAGGTAAAATAATAGCCTGAATATAATTAAGATAGTCTGTGTATACATCGATGAAAACATTGCCAATA
        
        
        
        See `Installation <doc/installation.rst>`__ and `Mirroring
        <doc/mirror.rst>`__ for more information.
        
        
        
        .. |pypi_rel| image:: https://badge.fury.io/py/biocommons.seqrepo.png
          :target: https://pypi.org/pypi?name=biocommons.seqrepo
          :align: middle
        
        .. |ci_rel| image:: https://travis-ci.org/biocommons/biocommons.seqrepo.svg?branch=master
          :target: https://travis-ci.org/biocommons/biocommons.seqrepo
          :align: middle 
        
        
Keywords: bioinformatics
Platform: UNKNOWN
Classifier: Development Status :: 3 - Alpha
Classifier: Intended Audience :: Developers
Classifier: Intended Audience :: Healthcare Industry
Classifier: Intended Audience :: Science/Research
Classifier: License :: OSI Approved :: Apache Software License
Classifier: Operating System :: OS Independent
Classifier: Programming Language :: Python
Classifier: Programming Language :: Python :: 2
Classifier: Programming Language :: Python :: 3
Classifier: Topic :: Database :: Front-Ends
Classifier: Topic :: Scientific/Engineering :: Bio-Informatics
Classifier: Topic :: Scientific/Engineering :: Medical Science Apps.
