Coverage for Bio.AlignIO.FastaIO : 4%
Hot-keys on this page
r m x p toggle line displays
j k next/prev highlighted chunk
0 (zero) top of page
1 (one) first highlighted chunk
|
# Copyright 2008-2011 by Peter Cock. All rights reserved. # # This code is part of the Biopython distribution and governed by its # license. Please see the LICENSE file that should have been included # as part of this package.
You are expected to use this module via the Bio.AlignIO functions (or the Bio.SeqIO functions if you want to work directly with the gapped sequences).
This module contains a parser for the pairwise alignments produced by Bill Pearson's FASTA tools, for use from the Bio.AlignIO interface where it is refered to as the "fasta-m10" file format (as we only support the machine readable output format selected with the -m 10 command line option).
This module does NOT cover the generic "fasta" file format originally developed as an input format to the FASTA tools. The Bio.AlignIO and Bio.SeqIO both use the Bio.SeqIO.FastaIO module to deal with these files, which can also be used to store a multiple sequence alignments. """
"""Helper function for the main parsing code (PRIVATE).
To get the actual pairwise alignment sequences, we must first translate the un-gapped sequence based coordinates into positions in the gapped sequence (which may have a flanking region shown using leading - characters). To date, I have never seen any trailing flanking region shown in the m10 file, but the following code should also cope with that.
Note that this code seems to work fine even when the "sq_offset" entries are prsent as a result of using the -X command line option. """ align_stripped = alignment_seq_with_flanking.strip("-") display_start = int(annotation['al_display_start']) if int(annotation['al_start']) <= int(annotation['al_stop']): start = int(annotation['al_start']) \ - display_start end = int(annotation['al_stop']) \ - display_start + 1 else: #FASTA has flipped this sequence... start = display_start \ - int(annotation['al_start']) end = display_start \ - int(annotation['al_stop']) + 1 end += align_stripped.count("-") assert 0 <= start and start < end and end <= len(align_stripped), \ "Problem with sequence start/stop,\n%s[%i:%i]\n%s" \ % (alignment_seq_with_flanking, start, end, annotation) return align_stripped[start:end]
"""Alignment iterator for the FASTA tool's pairwise alignment output.
This is for reading the pairwise alignments output by Bill Pearson's FASTA program when called with the -m 10 command line option for machine readable output. For more details about the FASTA tools, see the website http://fasta.bioch.virginia.edu/ and the paper:
W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448
This class is intended to be used via the Bio.AlignIO.parse() function by specifying the format as "fasta-m10" as shown in the following code:
from Bio import AlignIO handle = ... for a in AlignIO.parse(handle, "fasta-m10"): assert len(a) == 2, "Should be pairwise!" print("Alignment length %i" % a.get_alignment_length()) for record in a: print("%s %s %s" % (record.seq, record.name, record.id))
Note that this is not a full blown parser for all the information in the FASTA output - for example, most of the header and all of the footer is ignored. Also, the alignments are not batched according to the input queries.
Also note that there can be up to about 30 letters of flanking region included in the raw FASTA output as contextual information. This is NOT part of the alignment itself, and is not included in the resulting MultipleSeqAlignment objects returned. """ if alphabet is None: alphabet = single_letter_alphabet
state_PREAMBLE = -1 state_NONE = 0 state_QUERY_HEADER = 1 state_ALIGN_HEADER = 2 state_ALIGN_QUERY = 3 state_ALIGN_MATCH = 4 state_ALIGN_CONS = 5
def build_hsp(): if not query_tags and not match_tags: raise ValueError("No data for query %r, match %r" % (query_id, match_id)) assert query_tags, query_tags assert match_tags, match_tags evalue = align_tags.get("fa_expect", None) q = "?" # Just for printing len(q) in debug below m = "?" # Just for printing len(m) in debug below tool = global_tags.get("tool", "").upper() try: q = _extract_alignment_region(query_seq, query_tags) if tool in ["TFASTX"] and len(match_seq) == len(q): m = match_seq #Quick hack until I can work out how -, * and / characters #and the apparent mix of aa and bp coordinates works. else: m = _extract_alignment_region(match_seq, match_tags) assert len(q) == len(m) except AssertionError as err: print("Darn... amino acids vs nucleotide coordinates?") print(tool) print(query_seq) print(query_tags) print("%s %i" % (q, len(q))) print(match_seq) print(match_tags) print("%s %i" % (m, len(m))) print(handle.name) raise err
assert alphabet is not None alignment = MultipleSeqAlignment([], alphabet)
#TODO - Introduce an annotated alignment class? #For now, store the annotation a new private property: alignment._annotations = {}
#Want to record both the query header tags, and the alignment tags. for key, value in header_tags.items(): alignment._annotations[key] = value for key, value in align_tags.items(): alignment._annotations[key] = value
#Query #===== record = SeqRecord(Seq(q, alphabet), id=query_id, name="query", description=query_descr, annotations={"original_length": int(query_tags["sq_len"])}) #TODO - handle start/end coordinates properly. Short term hack for now: record._al_start = int(query_tags["al_start"]) record._al_stop = int(query_tags["al_stop"]) alignment.append(record)
#TODO - What if a specific alphabet has been requested? #TODO - Use an IUPAC alphabet? #TODO - Can FASTA output RNA? if alphabet == single_letter_alphabet and "sq_type" in query_tags: if query_tags["sq_type"] == "D": record.seq.alphabet = generic_dna elif query_tags["sq_type"] == "p": record.seq.alphabet = generic_protein if "-" in q: if not hasattr(record.seq.alphabet, "gap_char"): record.seq.alphabet = Gapped(record.seq.alphabet, "-")
#Match #===== record = SeqRecord(Seq(m, alphabet), id=match_id, name="match", description=match_descr, annotations={"original_length": int(match_tags["sq_len"])}) #TODO - handle start/end coordinates properly. Short term hack for now: record._al_start = int(match_tags["al_start"]) record._al_stop = int(match_tags["al_stop"]) alignment.append(record)
#This is still a very crude way of dealing with the alphabet: if alphabet == single_letter_alphabet and "sq_type" in match_tags: if match_tags["sq_type"] == "D": record.seq.alphabet = generic_dna elif match_tags["sq_type"] == "p": record.seq.alphabet = generic_protein if "-" in m: if not hasattr(record.seq.alphabet, "gap_char"): record.seq.alphabet = Gapped(record.seq.alphabet, "-")
return alignment
state = state_PREAMBLE query_id = None match_id = None query_descr = "" match_descr = "" global_tags = {} header_tags = {} align_tags = {} query_tags = {} match_tags = {} query_seq = "" match_seq = "" cons_seq = "" for line in handle: if ">>>" in line and not line.startswith(">>>"): if query_id and match_id: #This happens on old FASTA output which lacked an end of #query >>><<< marker line. yield build_hsp() state = state_NONE query_descr = line[line.find(">>>")+3:].strip() query_id = query_descr.split(None, 1)[0] match_id = None header_tags = {} align_tags = {} query_tags = {} match_tags = {} query_seq = "" match_seq = "" cons_seq = "" elif line.startswith("!! No "): #e.g. #!! No library sequences with E() < 0.5 #or on more recent versions, #No sequences with E() < 0.05 assert state == state_NONE assert not header_tags assert not align_tags assert not match_tags assert not query_tags assert match_id is None assert not query_seq assert not match_seq assert not cons_seq query_id = None elif line.strip() in [">>><<<", ">>>///"]: #End of query, possible end of all queries if query_id and match_id: yield build_hsp() state = state_NONE query_id = None match_id = None header_tags = {} align_tags = {} query_tags = {} match_tags = {} query_seq = "" match_seq = "" cons_seq = "" elif line.startswith(">>>"): #Should be start of a match! assert query_id is not None assert line[3:].split(", ", 1)[0] == query_id, line assert match_id is None assert not header_tags assert not align_tags assert not query_tags assert not match_tags assert not match_seq assert not query_seq assert not cons_seq state = state_QUERY_HEADER elif line.startswith(">>"): #Should now be at start of a match alignment! if query_id and match_id: yield build_hsp() align_tags = {} query_tags = {} match_tags = {} query_seq = "" match_seq = "" cons_seq = "" match_descr = line[2:].strip() match_id = match_descr.split(None, 1)[0] state = state_ALIGN_HEADER elif line.startswith(">--"): #End of one HSP assert query_id and match_id, line yield build_hsp() #Clean up read for next HSP #but reuse header_tags align_tags = {} query_tags = {} match_tags = {} query_seq = "" match_seq = "" cons_seq = "" state = state_ALIGN_HEADER elif line.startswith(">"): if state == state_ALIGN_HEADER: #Should be start of query alignment seq... assert query_id is not None, line assert match_id is not None, line assert query_id.startswith(line[1:].split(None, 1)[0]), line state = state_ALIGN_QUERY elif state == state_ALIGN_QUERY: #Should be start of match alignment seq assert query_id is not None, line assert match_id is not None, line assert match_id.startswith(line[1:].split(None, 1)[0]), line state = state_ALIGN_MATCH elif state == state_NONE: #Can get > as the last line of a histogram pass else: assert False, "state %i got %r" % (state, line) elif line.startswith("; al_cons"): assert state == state_ALIGN_MATCH, line state = state_ALIGN_CONS #Next line(s) should be consensus seq... elif line.startswith("; "): if ": " in line: key, value = [s.strip() for s in line[2:].split(": ", 1)] else: import warnings #Seen in lalign36, specifically version 36.3.4 Apr, 2011 #Fixed in version 36.3.5b Oct, 2011(preload8) warnings.warn("Missing colon in line: %r" % line) try: key, value = [s.strip() for s in line[2:].split(" ", 1)] except ValueError: raise ValueError("Bad line: %r" % line) if state == state_QUERY_HEADER: header_tags[key] = value elif state == state_ALIGN_HEADER: align_tags[key] = value elif state == state_ALIGN_QUERY: query_tags[key] = value elif state == state_ALIGN_MATCH: match_tags[key] = value else: assert False, "Unexpected state %r, %r" % (state, line) elif state == state_ALIGN_QUERY: query_seq += line.strip() elif state == state_ALIGN_MATCH: match_seq += line.strip() elif state == state_ALIGN_CONS: cons_seq += line.strip("\n") elif state == state_PREAMBLE: if line.startswith("#"): global_tags["command"] = line[1:].strip() elif line.startswith(" version "): global_tags["version"] = line[9:].strip() elif " compares a " in line: global_tags["tool"] = line[:line.find(" compares a ")].strip() elif " searches a " in line: global_tags["tool"] = line[:line.find(" searches a ")].strip() else: pass
print("Running a quick self-test")
#http://emboss.sourceforge.net/docs/themes/alnformats/align.simple simple_example = \ """# /opt/fasta/fasta34 -Q -H -E 1 -m 10 NC_002127.faa NC_009649.faa FASTA searches a protein or DNA sequence data bank version 34.26 January 12, 2007 Please cite: W.R. Pearson & D.J. Lipman PNAS (1988) 85:2444-2448
Query library NC_002127.faa vs NC_009649.faa library searching NC_009649.faa library
1>>>gi|10955263|ref|NP_052604.1| plasmid mobilization [Escherichia coli O157:H7 s 107 aa - 107 aa vs NC_009649.faa library
45119 residues in 180 sequences Expectation_n fit: rho(ln(x))= 6.9146+/-0.0249; mu= -5.7948+/- 1.273 mean_var=53.6859+/-13.609, 0's: 0 Z-trim: 1 B-trim: 9 in 1/25 Lambda= 0.175043
FASTA (3.5 Sept 2006) function [optimized, BL50 matrix (15:-5)] ktup: 2 join: 36, opt: 24, open/ext: -10/-2, width: 16 Scan time: 0.000 The best scores are: opt bits E(180) gi|152973457|ref|YP_001338508.1| ATPase with chape ( 931) 71 24.9 0.58 gi|152973588|ref|YP_001338639.1| F pilus assembly ( 459) 63 23.1 0.99
>>>gi|10955263|ref|NP_052604.1|, 107 aa vs NC_009649.faa library ; pg_name: /opt/fasta/fasta34 ; pg_ver: 34.26 ; pg_argv: /opt/fasta/fasta34 -Q -H -E 1 -m 10 NC_002127.faa NC_009649.faa ; pg_name: FASTA ; pg_ver: 3.5 Sept 2006 ; pg_matrix: BL50 (15:-5) ; pg_open-ext: -10 -2 ; pg_ktup: 2 ; pg_optcut: 24 ; pg_cgap: 36 ; mp_extrap: 60000 180 ; mp_stats: Expectation_n fit: rho(ln(x))= 6.9146+/-0.0249; mu= -5.7948+/- 1.273 mean_var=53.6859+/-13.609, 0's: 0 Z-trim: 1 B-trim: 9 in 1/25 Lambda= 0.175043 ; mp_KS: -0.0000 (N=0) at 8159228 >>gi|152973457|ref|YP_001338508.1| ATPase with chaperone activity, ATP-binding subunit [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] ; fa_frame: f ; fa_initn: 65 ; fa_init1: 43 ; fa_opt: 71 ; fa_z-score: 90.3 ; fa_bits: 24.9 ; fa_expect: 0.58 ; sw_score: 71 ; sw_ident: 0.250 ; sw_sim: 0.574 ; sw_overlap: 108 >gi|10955263| .. ; sq_len: 107 ; sq_offset: 1 ; sq_type: p ; al_start: 5 ; al_stop: 103 ; al_display_start: 1 --------------------------MTKRSGSNT-RRRAISRPVRLTAE ED---QEIRKRAAECGKTVSGFLRAAALGKKVNSLTDDRVLKEVM----- RLGALQKKLFIDGKRVGDREYAEVLIAITEYHRALLSRLMAD >gi|152973457|ref|YP_001338508.1| .. ; sq_len: 931 ; sq_type: p ; al_start: 96 ; al_stop: 195 ; al_display_start: 66 SDFFRIGDDATPVAADTDDVVDASFGEPAAAGSGAPRRRGSGLASRISEQ SEALLQEAAKHAAEFGRS------EVDTEHLLLALADSDVVKTILGQFKI KVDDLKRQIESEAKR-GDKPF-EGEIGVSPRVKDALSRAFVASNELGHSY VGPEHFLIGLAEEGEGLAANLLRRYGLTPQ >>gi|152973588|ref|YP_001338639.1| F pilus assembly protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] ; fa_frame: f ; fa_initn: 33 ; fa_init1: 33 ; fa_opt: 63 ; fa_z-score: 86.1 ; fa_bits: 23.1 ; fa_expect: 0.99 ; sw_score: 63 ; sw_ident: 0.266 ; sw_sim: 0.656 ; sw_overlap: 64 >gi|10955263| .. ; sq_len: 107 ; sq_offset: 1 ; sq_type: p ; al_start: 32 ; al_stop: 94 ; al_display_start: 2 TKRSGSNTRRRAISRPVRLTAEEDQEIRKRAAECGKTVSGFLRAAALGKK VNSLTDDRVLKEV-MRLGALQKKLFIDGKRVGDREYAEVLIAITEYHRAL LSRLMAD >gi|152973588|ref|YP_001338639.1| .. ; sq_len: 459 ; sq_type: p ; al_start: 191 ; al_stop: 248 ; al_display_start: 161 VGGLFPRTQVAQQKVCQDIAGESNIFSDWAASRQGCTVGG--KMDSVQDK ASDKDKERVMKNINIMWNALSKNRLFDG----NKELKEFIMTLTGTLIFG ENSEITPLPARTTDQDLIRAMMEGGTAKIYHCNDSDKCLKVVADATVTIT SNKALKSQISALLSSIQNKAVADEKLTDQE 2>>>gi|10955264|ref|NP_052605.1| hypothetical protein pOSAK1_02 [Escherichia coli O157:H7 s 126 aa - 126 aa vs NC_009649.faa library
45119 residues in 180 sequences Expectation_n fit: rho(ln(x))= 7.1374+/-0.0246; mu= -7.6540+/- 1.313 mean_var=51.1189+/-13.171, 0's: 0 Z-trim: 1 B-trim: 8 in 1/25 Lambda= 0.179384
FASTA (3.5 Sept 2006) function [optimized, BL50 matrix (15:-5)] ktup: 2 join: 36, opt: 24, open/ext: -10/-2, width: 16 Scan time: 0.000 The best scores are: opt bits E(180) gi|152973462|ref|YP_001338513.1| hypothetical prot ( 101) 58 22.9 0.29
>>>gi|10955264|ref|NP_052605.1|, 126 aa vs NC_009649.faa library ; pg_name: /opt/fasta/fasta34 ; pg_ver: 34.26 ; pg_argv: /opt/fasta/fasta34 -Q -H -E 1 -m 10 NC_002127.faa NC_009649.faa ; pg_name: FASTA ; pg_ver: 3.5 Sept 2006 ; pg_matrix: BL50 (15:-5) ; pg_open-ext: -10 -2 ; pg_ktup: 2 ; pg_optcut: 24 ; pg_cgap: 36 ; mp_extrap: 60000 180 ; mp_stats: Expectation_n fit: rho(ln(x))= 7.1374+/-0.0246; mu= -7.6540+/- 1.313 mean_var=51.1189+/-13.171, 0's: 0 Z-trim: 1 B-trim: 8 in 1/25 Lambda= 0.179384 ; mp_KS: -0.0000 (N=0) at 8159228 >>gi|152973462|ref|YP_001338513.1| hypothetical protein KPN_pKPN3p05904 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] ; fa_frame: f ; fa_initn: 50 ; fa_init1: 50 ; fa_opt: 58 ; fa_z-score: 95.8 ; fa_bits: 22.9 ; fa_expect: 0.29 ; sw_score: 58 ; sw_ident: 0.289 ; sw_sim: 0.632 ; sw_overlap: 38 >gi|10955264| .. ; sq_len: 126 ; sq_offset: 1 ; sq_type: p ; al_start: 1 ; al_stop: 38 ; al_display_start: 1 ------------------------------MKKDKKYQIEAIKNKDKTLF IVYATDIYSPSEFFSKIESDLKKKKSKGDVFFDLIIPNGGKKDRYVYTSF NGEKFSSYTLNKVTKTDEYN >gi|152973462|ref|YP_001338513.1| .. ; sq_len: 101 ; sq_type: p ; al_start: 44 ; al_stop: 81 ; al_display_start: 14 DALLGEIQRLRKQVHQLQLERDILTKANELIKKDLGVSFLKLKNREKTLI VDALKKKYPVAELLSVLQLARSCYFYQNVCTISMRKYA 3>>>gi|10955265|ref|NP_052606.1| hypothetical protein pOSAK1_03 [Escherichia coli O157:H7 s 346 aa - 346 aa vs NC_009649.faa library
45119 residues in 180 sequences Expectation_n fit: rho(ln(x))= 6.0276+/-0.0276; mu= 3.0670+/- 1.461 mean_var=37.1634+/- 8.980, 0's: 0 Z-trim: 1 B-trim: 14 in 1/25 Lambda= 0.210386
FASTA (3.5 Sept 2006) function [optimized, BL50 matrix (15:-5)] ktup: 2 join: 37, opt: 25, open/ext: -10/-2, width: 16 Scan time: 0.020 The best scores are: opt bits E(180) gi|152973545|ref|YP_001338596.1| putative plasmid ( 242) 70 27.5 0.082
>>>gi|10955265|ref|NP_052606.1|, 346 aa vs NC_009649.faa library ; pg_name: /opt/fasta/fasta34 ; pg_ver: 34.26 ; pg_argv: /opt/fasta/fasta34 -Q -H -E 1 -m 10 NC_002127.faa NC_009649.faa ; pg_name: FASTA ; pg_ver: 3.5 Sept 2006 ; pg_matrix: BL50 (15:-5) ; pg_open-ext: -10 -2 ; pg_ktup: 2 ; pg_optcut: 25 ; pg_cgap: 37 ; mp_extrap: 60000 180 ; mp_stats: Expectation_n fit: rho(ln(x))= 6.0276+/-0.0276; mu= 3.0670+/- 1.461 mean_var=37.1634+/- 8.980, 0's: 0 Z-trim: 1 B-trim: 14 in 1/25 Lambda= 0.210386 ; mp_KS: -0.0000 (N=0) at 8159228 >>gi|152973545|ref|YP_001338596.1| putative plasmid SOS inhibition protein A [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] ; fa_frame: f ; fa_initn: 52 ; fa_init1: 52 ; fa_opt: 70 ; fa_z-score: 105.5 ; fa_bits: 27.5 ; fa_expect: 0.082 ; sw_score: 70 ; sw_ident: 0.279 ; sw_sim: 0.651 ; sw_overlap: 43 >gi|10955265| .. ; sq_len: 346 ; sq_offset: 1 ; sq_type: p ; al_start: 197 ; al_stop: 238 ; al_display_start: 167 DFMCSILNMKEIVEQKNKEFNVDIKKETIESELHSKLPKSIDKIHEDIKK QLSC-SLIMKKIDVEMEDYSTYCFSALRAIEGFIYQILNDVCNPSSSKNL GEYFTENKPKYIIREIHQET >gi|152973545|ref|YP_001338596.1| .. ; sq_len: 242 ; sq_type: p ; al_start: 52 ; al_stop: 94 ; al_display_start: 22 IMTVEEARQRGARLPSMPHVRTFLRLLTGCSRINSDVARRIPGIHRDPKD RLSSLKQVEEALDMLISSHGEYCPLPLTMDVQAENFPEVLHTRTVRRLKR QDFAFTRKMRREARQVEQSW >>><<<
579 residues in 3 query sequences 45119 residues in 180 library sequences Scomplib [34.26] start: Tue May 20 16:38:45 2008 done: Tue May 20 16:38:45 2008 Total Scan time: 0.020 Total Display time: 0.010
Function used was FASTA [version 34.26 January 12, 2007]
"""
from Bio._py3k import StringIO
alignments = list(FastaM10Iterator(StringIO(simple_example))) assert len(alignments) == 4, len(alignments) assert len(alignments[0]) == 2 for a in alignments: print("Alignment %i sequences of length %i" \ % (len(a), a.get_alignment_length())) for r in a: print("%s %s %i" % (r.seq, r.id, r.annotations["original_length"])) #print(a.annotations) print("Done")
import os path = "../../Tests/Fasta/" files = sorted(f for f in os.listdir(path) if os.path.splitext(f)[-1] == ".m10") for filename in files: if os.path.splitext(filename)[-1] == ".m10": print("") print(filename) print("=" * len(filename)) for i, a in enumerate(FastaM10Iterator(open(os.path.join(path, filename)))): print("#%i, %s" % (i+1, a)) for r in a: if "-" in r.seq: assert r.seq.alphabet.gap_char == "-" else: assert not hasattr(r.seq.alphabet, "gap_char") |