Metadata-Version: 2.1
Name: atai
Version: 0.0.2
Summary: Atomic AI – An attempt at a minimalist, flexible deep learning framework for diverse models.
Home-page: https://github.com/frenio/atai
Author: Frenio Redeker
Author-email: f.redeker@gmail.com
License: Apache Software License 2.0
Keywords: nbdev jupyter notebook python
Classifier: Development Status :: 4 - Beta
Classifier: Intended Audience :: Developers
Classifier: Natural Language :: English
Classifier: Programming Language :: Python :: 3.7
Classifier: Programming Language :: Python :: 3.8
Classifier: Programming Language :: Python :: 3.9
Classifier: Programming Language :: Python :: 3.10
Classifier: License :: OSI Approved :: Apache Software License
Requires-Python: >=3.7
Description-Content-Type: text/markdown
License-File: LICENSE
Requires-Dist: math
Requires-Dist: matplotlib
Requires-Dist: numpy
Requires-Dist: torch
Requires-Dist: torcheval
Requires-Dist: torchmetrics
Requires-Dist: fastcore
Requires-Dist: fastprogress
Provides-Extra: dev

# atai


<!-- WARNING: THIS FILE WAS AUTOGENERATED! DO NOT EDIT! -->

Atomic AI is a flexible, minimalist deep neural network training
framework based on Jeremy Howard’s
[miniai](https://github.com/fastai/course22p2/tree/master) from the
[fast.ai 2022](https://course.fast.ai/Lessons/part2.html) course.

## Install

``` sh
pip install atai
```

## How to use

``` python
from atai.core import *
```

The following example demonstrates how the Atomic AI training framework
can be used to train a custom model that predicts protein solubility.

### Imports

``` python
import torch
import torch.nn.functional as F
import torch.nn as nn
from torch.nn import init
from torch import optim

from torcheval.metrics import BinaryAccuracy, BinaryAUROC
from torcheval.metrics.functional import binary_auroc, binary_accuracy
from torchmetrics.classification import BinaryMatthewsCorrCoef
from torchmetrics.functional.classification import binary_matthews_corrcoef

import fastcore.all as fc
from functools import partial
```

### Load Protein Solubility

This example uses the dataset from the
[DeepSol](https://doi.org/10.1093/bioinformatics/bty166) paper by
Khurana *et al.* which was obtained at
<https://zenodo.org/records/1162886>. It consists of amino acid
sequences of peptides along with solubility labels that are `1` if the
peptide is soluble and `0` if the peptide is insoluble.

``` python
train_sqs = open('sol_data/train_src', 'r').read().splitlines()
train_tgs = list(map(int, open('sol_data/train_tgt', 'r').read().splitlines()))

valid_sqs = open('sol_data/val_src', 'r').read().splitlines()
valid_tgs = list(map(int, open('sol_data/val_tgt', 'r').read().splitlines()))

train_sqs[:2], train_tgs[:2]
```

    (['GMILKTNLFGHTYQFKSITDVLAKANEEKSGDRLAGVAAESAEERVAAKVVLSKMTLGDLRNNPVVPYETDEVTRIIQDQVNDRIHDSIKNWTVEELREWILDHKTTDADIKRVARGLTSEIIAAVTKLMSNLDLIYGAKKIRVIAHANTTIGLPGTFSARLQPNHPTDDPDGILASLMEGLTYGIGDAVIGLNPVDDSTDSVVRLLNKFEEFRSKWDVPTQTCVLAHVKTQMEAMRRGAPTGLVFQSIAGSEKGNTAFGFDGATIEEARQLALQSGAATGPNVMYFETGQGSELSSDAHFGVDQVTMEARCYGFAKKFDPFLVNTVVGFIGPEYLYDSKQVIRAGLEDHFMGKLTGISMGCDVCYTNHMKADQNDVENLSVLLTAAGCNFIMGIPHGDDVMLNYQTTGYHETATLRELFGLKPIKEFDQWMEKMGFSENGKLTSRAGDASIFLK',
      'MAHHHHHHMSFFRMKRRLNFVVKRGIEELWENSFLDNNVDMKKIEYSKTGDAWPCVLLRKKSFEDLHKLYYICLKEKNKLLGEQYFHLQNSTKMLQHGRLKKVKLTMKRILTVLSRRAIHDQCLRAKDMLKKQEEREFYEIQKFKLNEQLLCLKHKMNILKKYNSFSLEQISLTFSIKKIENKIQQIDIILNPLRKETMYLLIPHFKYQRKYSDLPGFISWKKQNIIALRNNMSKLHRLY'],
     [1, 0])

``` python
len(train_sqs), len(train_tgs), len(valid_sqs), len(valid_tgs)
```

    (62478, 62478, 6942, 6942)

### Data Preparation

Create a sorted list of amino acid sequences `aas` including an empty
string for padding and determine the size of the vocabulary.

``` python
aas = sorted(list(set("".join(train_sqs))) + [""])
vocab_size = len(aas)
aas, vocab_size
```

    (['',
      'A',
      'C',
      'D',
      'E',
      'F',
      'G',
      'H',
      'I',
      'K',
      'L',
      'M',
      'N',
      'P',
      'Q',
      'R',
      'S',
      'T',
      'V',
      'W',
      'Y'],
     21)

Create dictionaries that translate between string and integer
representations of amino acids and define the corresponding `encode` and
`decode` functions.

``` python
str2int = {aa:i for i, aa in enumerate(aas)}
int2str = {i:aa for i, aa in enumerate(aas)}
encode = lambda s: [str2int[aa] for aa in s]
decode = lambda l: ''.join([int2str[i] for i in l])

print(encode("AYWCCCGGGHH"))
print(decode(encode("AYWCCCGGGHH")))
```

    [1, 20, 19, 2, 2, 2, 6, 6, 6, 7, 7]
    AYWCCCGGGHH

Figure out what the range of lengths of amino acid sequences in the
dataset is.

``` python
train_lens = list(map(len, train_sqs))
min(train_lens), max(train_lens)
```

    (19, 1691)

Create a function that drops all sequences above a chosen threshold and
also returns a list of indices of the sequences that meet the threshold
that can be used to obtain the correct labels.

``` python
def drop_long_sqs(sqs, threshold=1200):
    new_sqs = []
    idx = []
    for i, sq in enumerate(sqs):
        if len(sq) <= threshold:
            new_sqs.append(sq)
            idx.append(i)
    return new_sqs, idx
```

Drop all sequences above your chosen threshold.

``` python
trnsqs, trnidx = drop_long_sqs(train_sqs, threshold=200)
vldsqs, vldidx = drop_long_sqs(valid_sqs, threshold=200)
```

``` python
len(trnidx), len(vldidx)
```

    (18066, 1971)

``` python
max(map(len, trnsqs))
```

    200

Create a function for zero padding all sequences.

``` python
def zero_pad(sq, length=1200):
    new_sq = sq.copy()
    if len(new_sq) < length:
        new_sq.extend([0] * (length-len(new_sq)))
    return new_sq
```

Now encode and zero pad all sequences and make sure that it worked out
correctly.

``` python
trn = list(map(encode, trnsqs))
vld = list(map(encode, vldsqs))
print(f"Length of the first two sequences before zero padding: {len(trn[0])}, {len(trn[1])}")
trn = list(map(partial(zero_pad, length=200), trn))
vld = list(map(partial(zero_pad, length=200), vld))
print(f"Length of the first two sequences after zero padding:  {len(trn[0])}, {len(trn[1])}");
```

    Length of the first two sequences before zero padding: 116, 135
    Length of the first two sequences after zero padding:  200, 200

Convert the data to `torch.tensor`s unsing `dtype=torch.int64` and check
for correctness.

``` python
trntns = torch.tensor(trn, dtype=torch.int64)
vldtns = torch.tensor(vld, dtype=torch.int64)
trntns.shape, trntns[0]
```

    (torch.Size([18066, 200]),
     tensor([11,  9,  1, 10,  2, 10, 10, 10, 10, 13, 18, 10,  6, 10, 10, 18, 16, 16,  9, 17, 10,  2, 16, 11,  4,  4,  1,  8, 12,  4, 15,  8, 14,
              4, 18,  1,  6, 16, 10,  8,  5, 15,  1,  8, 16, 16,  8,  6, 10,  4,  2, 14, 16, 18, 17, 16, 15,  6,  3, 10,  1, 17,  2, 13, 15,  6,
              5,  1, 18, 17,  6,  2, 17,  2,  6, 16,  1,  2,  6, 16, 19,  3, 18, 15,  1,  4, 17, 17,  2,  7,  2, 14,  2,  1,  6, 11,  3, 19, 17,
              6,  1, 15,  2,  2, 15, 18, 14, 13, 10,  4,  7,  7,  7,  7,  7,  7,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,
              0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,
              0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,
              0,  0]))

``` python
trntns.shape, vldtns.shape
```

    (torch.Size([18066, 200]), torch.Size([1971, 200]))

Obtain the correct labels using the lists of indices obtained from the
`drop_long_sqs` function and convert the lists of labels to tensors in
`torch.float32` format.

``` python
trnlbs = torch.tensor(train_tgs, dtype=torch.float32)[trnidx]
vldlbs = torch.tensor(valid_tgs, dtype=torch.float32)[vldidx]
trnlbs.shape, vldlbs.shape
```

    (torch.Size([18066]), torch.Size([1971]))

Calculate the ratios of soluble peptides in the train and valid data.

``` python
trnlbs.sum().item()/trnlbs.shape[0], vldlbs.sum().item()/vldlbs.shape[0]
```

    (0.4722129967895494, 0.4657534246575342)

These ratios tell us that there are slightly less than half soluble
proteins in the training an validation data, and slightly more than half
in the test set.

### Dataset and DataLoaders

Turn train and valid data into datasets using the
[`Dataset`](https://frenio.github.io/atai/core.html#dataset) class.

``` python
trnds = Dataset(trntns, trnlbs)
vldds = Dataset(vldtns, vldlbs)
trnds[0]
```

    (tensor([11,  9,  1, 10,  2, 10, 10, 10, 10, 13, 18, 10,  6, 10, 10, 18, 16, 16,  9, 17, 10,  2, 16, 11,  4,  4,  1,  8, 12,  4, 15,  8, 14,
              4, 18,  1,  6, 16, 10,  8,  5, 15,  1,  8, 16, 16,  8,  6, 10,  4,  2, 14, 16, 18, 17, 16, 15,  6,  3, 10,  1, 17,  2, 13, 15,  6,
              5,  1, 18, 17,  6,  2, 17,  2,  6, 16,  1,  2,  6, 16, 19,  3, 18, 15,  1,  4, 17, 17,  2,  7,  2, 14,  2,  1,  6, 11,  3, 19, 17,
              6,  1, 15,  2,  2, 15, 18, 14, 13, 10,  4,  7,  7,  7,  7,  7,  7,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,
              0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,
              0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,
              0,  0]),
     tensor(0.))

Use the [`get_dls`](https://frenio.github.io/atai/core.html#get_dls)
function to obtain the dataloaders from the train and valid datasets.

``` python
dls = get_dls(trnds, vldds, bs=32)
next(iter(dls.train))[0][:2], next(iter(dls.train))[1][:2]
```

    (tensor([[10, 15, 16, 18,  5, 18, 16,  6,  5, 13, 15,  6, 18,  3, 16,  1, 14, 10, 16,  4, 20,  5, 10,  1,  5,  6, 13, 18,  1, 16, 18, 18, 11,
               3,  9,  3,  9,  6, 18,  5,  1,  8, 18,  4, 11,  6,  3, 18,  6,  1, 15,  4,  1, 18, 10, 16, 14, 16, 14,  7, 16, 10,  6,  6,  7, 15,
              10, 15, 18, 15, 13, 15,  4, 14,  9,  4,  5, 14, 16, 13,  1, 16,  9, 16, 13,  9,  6,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,
               0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,
               0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,
               0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,  0,
               0,  0],
             [11, 12, 13, 16,  1, 13, 16, 20, 13, 11,  1, 16, 10, 20, 18,  6,  3, 10,  7, 13,  3, 18, 17,  4,  1, 11, 10, 20,  4,  9,  5, 16, 13,
               1,  6, 13,  8, 10, 16,  8, 15, 18,  2, 15,  3, 11,  8, 17, 15, 15, 16, 10,  6, 20,  1, 20, 18, 12,  5, 14, 14, 13,  1,  3,  1,  4,
              15,  1, 10,  3, 17, 11, 12,  5,  3, 18,  8,  9,  6,  9, 13, 18, 15,  8, 11, 19, 16, 14, 15,  3, 13, 16, 10, 15,  9, 16,  6, 18,  6,
              12,  8,  5,  8,  9, 12, 10,  3,  9, 16,  8,  3, 12,  9,  1, 10, 20,  3, 17,  5, 16,  1,  5,  6, 12,  8, 10, 16,  2,  9, 18, 18,  2,
               3,  4, 12,  6, 16,  9,  6, 20,  6,  5, 18,  7,  5,  4, 17, 14,  4,  1,  1,  4, 15,  1,  8,  4,  9, 11, 12,  6, 11, 10, 10, 12,  3,
              15,  9, 18,  5, 18,  6, 15,  5,  9, 16, 15,  9,  4, 15,  4,  1,  4, 10,  6,  1, 15,  1,  9,  4,  5,  0,  0,  0,  0,  0,  0,  0,  0,
               0,  0]]),
     tensor([1., 1.]))

### Design Your Model

Let’s create a tiny model (~10k parameters) that uses a sequence of
1-dimensional convolutional layers with skip connections, kaiming he
initialization, leaky relus, batchnorm, and dropout.

First, obtain a single batch from `dls` to help design the model.

``` python
idx = next(iter(dls.train))[0] ## a single batch
idx, idx.shape
```

    (tensor([[11,  9,  9,  ...,  0,  0,  0],
             [11,  3, 20,  ...,  0,  0,  0],
             [ 1,  5,  4,  ...,  0,  0,  0],
             ...,
             [ 1, 18, 18,  ...,  0,  0,  0],
             [10,  6,  5,  ...,  0,  0,  0],
             [ 2,  8,  1,  ...,  0,  0,  0]]),
     torch.Size([32, 200]))

#### Custom Modules

``` python
def conv1d(ni, nf, ks=3, stride=2, act=nn.ReLU, norm=None, bias=None):
    if bias is None: bias = not isinstance(norm, (nn.BatchNorm1d,nn.BatchNorm2d,nn.BatchNorm3d))
    layers = [nn.Conv1d(ni, nf, stride=stride, kernel_size=ks, padding=ks//2, bias=bias)]
    if norm: layers.append(norm(nf))
    if act: layers.append(act())
    return nn.Sequential(*layers)

def _conv1d_block(ni, nf, stride, act=nn.ReLU, norm=None, ks=3):
    return nn.Sequential(conv1d(ni, nf, stride=1, act=act, norm=norm, ks=ks),
                         conv1d(nf, nf, stride=stride, act=None, norm=norm, ks=ks))

class ResBlock1d(nn.Module):
    def __init__(self, ni, nf, stride=1, ks=3, act=nn.ReLU, norm=None):
        super().__init__()
        self.convs = _conv1d_block(ni, nf, stride=stride, ks=ks, act=act, norm=norm)
        self.idconv = fc.noop if ni==nf else conv1d(ni, nf, stride=1, ks=1, act=None)
        self.pool = fc.noop if stride==1 else nn.AvgPool1d(stride, ceil_mode=True)
        self.act = act()

    def forward(self, x): return self.act(self.convs(x) + self.pool(self.idconv(x)))
```

The following module switches the rank order from BLC to BCL.

``` python
class Reshape(nn.Module):
    def forward(self, x): 
        B, L, C = x.shape
        return x.view(B, C, L)
```

#### Model Architecture

``` python
lr = 1e-2
epochs = 30
n_embd = 16
dls = get_dls(trnds, vldds, bs=32)
act_genrelu = partial(GeneralRelu, leak=0.1, sub=0.4)

model = nn.Sequential(nn.Embedding(vocab_size, n_embd, padding_idx=0), Reshape(),
                      ResBlock1d(n_embd, 2, ks=15, stride=2, norm=nn.BatchNorm1d, act=act_genrelu), nn.Dropout(0.1),
                      ResBlock1d(2, 4, ks=13, stride=2, norm=nn.BatchNorm1d, act=act_genrelu), nn.Dropout(0.1),
                      ResBlock1d(4, 4, ks=11, stride=2, norm=nn.BatchNorm1d, act=act_genrelu), nn.Dropout(0.1),
                      ResBlock1d(4, 4, ks=9, stride=2, norm=nn.BatchNorm1d, act=act_genrelu), nn.Dropout(0.1),
                      ResBlock1d(4, 8, ks=7, stride=2, norm=nn.BatchNorm1d, act=act_genrelu), nn.Dropout(0.1),
                      ResBlock1d(8, 8, ks=5, stride=2, norm=nn.BatchNorm1d, act=act_genrelu), nn.Dropout(0.1),
                      ResBlock1d(8, 16, ks=3, stride=2, norm=nn.BatchNorm1d, act=act_genrelu), nn.Dropout(0.1),
                      ResBlock1d(16, 32, ks=3, stride=2, norm=nn.BatchNorm1d, act=act_genrelu), nn.Dropout(0.1),
                      nn.Flatten(1, -1),
                      nn.Linear(32, 1),
                      nn.Flatten(0, -1),
                      nn.Sigmoid())
model(idx).shape
```

    torch.Size([32])

``` python
iw = partial(init_weights, leaky=0.1)
model = model.apply(iw)
metrics = MetricsCB(BinaryAccuracy(), BinaryMatthewsCorrCoef(), BinaryAUROC())
astats = ActivationStats(fc.risinstance(GeneralRelu))
cbs = [DeviceCB(), ProgressCB(plot=False), metrics, astats]
learn = TrainLearner(model, dls, F.binary_cross_entropy, lr=lr, cbs=cbs, opt_func=torch.optim.AdamW)
print(f"Parameters total: {sum(p.nelement() for p in model.parameters())}")
learn.lr_find(start_lr=1e-4, gamma=1.05, av_over=3, max_mult=5)
```

    Parameters total: 10175

<style>
    /* Turns off some styling */
    progress {
        /* gets rid of default border in Firefox and Opera. */
        border: none;
        /* Needs to be in here for Safari polyfill so background images work as expected. */
        background-size: auto;
    }
    progress:not([value]), progress:not([value])::-webkit-progress-bar {
        background: repeating-linear-gradient(45deg, #7e7e7e, #7e7e7e 10px, #5c5c5c 10px, #5c5c5c 20px);
    }
    .progress-bar-interrupted, .progress-bar-interrupted::-webkit-progress-bar {
        background: #F44336;
    }
</style>

    <div>
      <progress value='0' class='' max='10' style='width:300px; height:20px; vertical-align: middle;'></progress>
      0.00% [0/10 00:00&lt;?]
    </div>
    &#10;
&#10;    <div>
      <progress value='492' class='' max='565' style='width:300px; height:20px; vertical-align: middle;'></progress>
      87.08% [492/565 00:33&lt;00:04 2.113]
    </div>
    &#10;
![](index_files/figure-commonmark/cell-25-output-4.png)

This is a pretty noisy training set, so the learning rate finder does
not work very well. Yet it is possible to get a somewhat informative
result using the `av_over` keyword argument that tells
[`lr_find`](https://frenio.github.io/atai/core.html#lr_find) to average
over the specified number of batches for each learning rate tested. It
also helps to dial the `gamma` value down from its default value of
`1.3`.

### Training

``` python
learn.fit(epochs)
```

<style>
    /* Turns off some styling */
    progress {
        /* gets rid of default border in Firefox and Opera. */
        border: none;
        /* Needs to be in here for Safari polyfill so background images work as expected. */
        background-size: auto;
    }
    progress:not([value]), progress:not([value])::-webkit-progress-bar {
        background: repeating-linear-gradient(45deg, #7e7e7e, #7e7e7e 10px, #5c5c5c 10px, #5c5c5c 20px);
    }
    .progress-bar-interrupted, .progress-bar-interrupted::-webkit-progress-bar {
        background: #F44336;
    }
</style>

<div>

| BinaryAccuracy | BinaryMatthewsCorrCoef | BinaryAUROC | loss  | epoch | train |
|----------------|------------------------|-------------|-------|-------|-------|
| 0.507          | 0.001                  | 0.504       | 0.718 | 0     | train |
| 0.534          | -0.021                 | 0.514       | 0.691 | 0     | eval  |
| 0.515          | 0.008                  | 0.506       | 0.697 | 1     | train |
| 0.539          | 0.040                  | 0.530       | 0.691 | 1     | eval  |
| 0.519          | 0.015                  | 0.509       | 0.695 | 2     | train |
| 0.534          | 0.003                  | 0.498       | 0.691 | 2     | eval  |
| 0.519          | 0.017                  | 0.517       | 0.694 | 3     | train |
| 0.525          | 0.036                  | 0.527       | 0.692 | 3     | eval  |
| 0.582          | 0.155                  | 0.592       | 0.675 | 4     | train |
| 0.638          | 0.283                  | 0.649       | 0.633 | 4     | eval  |
| 0.618          | 0.242                  | 0.629       | 0.652 | 5     | train |
| 0.651          | 0.321                  | 0.666       | 0.619 | 5     | eval  |
| 0.627          | 0.266                  | 0.630       | 0.647 | 6     | train |
| 0.656          | 0.329                  | 0.664       | 0.618 | 6     | eval  |
| 0.635          | 0.286                  | 0.637       | 0.641 | 7     | train |
| 0.647          | 0.332                  | 0.679       | 0.623 | 7     | eval  |
| 0.636          | 0.284                  | 0.648       | 0.637 | 8     | train |
| 0.645          | 0.309                  | 0.680       | 0.614 | 8     | eval  |
| 0.635          | 0.281                  | 0.647       | 0.636 | 9     | train |
| 0.649          | 0.346                  | 0.682       | 0.627 | 9     | eval  |
| 0.636          | 0.286                  | 0.656       | 0.632 | 10    | train |
| 0.654          | 0.340                  | 0.684       | 0.613 | 10    | eval  |
| 0.646          | 0.304                  | 0.666       | 0.627 | 11    | train |
| 0.653          | 0.314                  | 0.686       | 0.614 | 11    | eval  |
| 0.645          | 0.299                  | 0.665       | 0.627 | 12    | train |
| 0.666          | 0.327                  | 0.702       | 0.605 | 12    | eval  |
| 0.648          | 0.301                  | 0.676       | 0.622 | 13    | train |
| 0.665          | 0.340                  | 0.704       | 0.600 | 13    | eval  |
| 0.657          | 0.319                  | 0.684       | 0.619 | 14    | train |
| 0.670          | 0.333                  | 0.717       | 0.609 | 14    | eval  |
| 0.656          | 0.318                  | 0.688       | 0.616 | 15    | train |
| 0.655          | 0.313                  | 0.703       | 0.619 | 15    | eval  |
| 0.652          | 0.308                  | 0.682       | 0.619 | 16    | train |
| 0.674          | 0.352                  | 0.719       | 0.597 | 16    | eval  |
| 0.659          | 0.324                  | 0.692       | 0.614 | 17    | train |
| 0.662          | 0.348                  | 0.717       | 0.606 | 17    | eval  |
| 0.658          | 0.320                  | 0.693       | 0.613 | 18    | train |
| 0.668          | 0.336                  | 0.718       | 0.604 | 18    | eval  |
| 0.657          | 0.316                  | 0.698       | 0.612 | 19    | train |
| 0.662          | 0.339                  | 0.715       | 0.602 | 19    | eval  |
| 0.660          | 0.325                  | 0.697       | 0.612 | 20    | train |
| 0.662          | 0.330                  | 0.716       | 0.607 | 20    | eval  |
| 0.665          | 0.334                  | 0.700       | 0.611 | 21    | train |
| 0.662          | 0.317                  | 0.703       | 0.609 | 21    | eval  |
| 0.665          | 0.337                  | 0.698       | 0.609 | 22    | train |
| 0.666          | 0.326                  | 0.712       | 0.607 | 22    | eval  |
| 0.666          | 0.336                  | 0.703       | 0.608 | 23    | train |
| 0.677          | 0.360                  | 0.723       | 0.591 | 23    | eval  |
| 0.663          | 0.330                  | 0.703       | 0.608 | 24    | train |
| 0.676          | 0.358                  | 0.722       | 0.595 | 24    | eval  |
| 0.666          | 0.335                  | 0.708       | 0.607 | 25    | train |
| 0.675          | 0.361                  | 0.723       | 0.594 | 25    | eval  |
| 0.661          | 0.323                  | 0.707       | 0.608 | 26    | train |
| 0.664          | 0.321                  | 0.708       | 0.615 | 26    | eval  |
| 0.664          | 0.328                  | 0.710       | 0.605 | 27    | train |
| 0.663          | 0.322                  | 0.723       | 0.602 | 27    | eval  |
| 0.669          | 0.337                  | 0.711       | 0.606 | 28    | train |
| 0.647          | 0.290                  | 0.701       | 0.619 | 28    | eval  |
| 0.669          | 0.339                  | 0.715       | 0.602 | 29    | train |
| 0.665          | 0.336                  | 0.719       | 0.605 | 29    | eval  |

</div>

### Inspect Activations

``` python
dls = get_dls(trnds, vldds, bs=256)

model = nn.Sequential(nn.Embedding(vocab_size, n_embd, padding_idx=0), Reshape(),
                      ResBlock1d(n_embd, 2, ks=15, stride=2, norm=nn.BatchNorm1d, act=act_genrelu), nn.Dropout(0.1),
                      ResBlock1d(2, 4, ks=13, stride=2, norm=nn.BatchNorm1d, act=act_genrelu), nn.Dropout(0.1),
                      ResBlock1d(4, 4, ks=11, stride=2, norm=nn.BatchNorm1d, act=act_genrelu), nn.Dropout(0.1),
                      ResBlock1d(4, 4, ks=9, stride=2, norm=nn.BatchNorm1d, act=act_genrelu), nn.Dropout(0.1),
                      ResBlock1d(4, 8, ks=7, stride=2, norm=nn.BatchNorm1d, act=act_genrelu), nn.Dropout(0.1),
                      ResBlock1d(8, 8, ks=5, stride=2, norm=nn.BatchNorm1d, act=act_genrelu), nn.Dropout(0.1),
                      ResBlock1d(8, 16, ks=3, stride=2, norm=nn.BatchNorm1d, act=act_genrelu), nn.Dropout(0.1),
                      ResBlock1d(16, 32, ks=3, stride=2, norm=nn.BatchNorm1d, act=act_genrelu), nn.Dropout(0.1),
                      nn.Flatten(1, -1),
                      nn.Linear(32, 1),
                      nn.Flatten(0, -1),
                      nn.Sigmoid())

model = model.apply(iw)
metrics = MetricsCB(BinaryAccuracy(), BinaryMatthewsCorrCoef(), BinaryAUROC())
astats = ActivationStats(fc.risinstance(GeneralRelu))
cbs = [DeviceCB(), ProgressCB(plot=False), metrics, astats]
learn = TrainLearner(model, dls, F.binary_cross_entropy, lr=lr, cbs=cbs, opt_func=torch.optim.AdamW)
print(f"Parameters total: {sum(p.nelement() for p in model.parameters())}")
learn.fit(1)
```

    Parameters total: 10175

<style>
    /* Turns off some styling */
    progress {
        /* gets rid of default border in Firefox and Opera. */
        border: none;
        /* Needs to be in here for Safari polyfill so background images work as expected. */
        background-size: auto;
    }
    progress:not([value]), progress:not([value])::-webkit-progress-bar {
        background: repeating-linear-gradient(45deg, #7e7e7e, #7e7e7e 10px, #5c5c5c 10px, #5c5c5c 20px);
    }
    .progress-bar-interrupted, .progress-bar-interrupted::-webkit-progress-bar {
        background: #F44336;
    }
</style>

<div>

| BinaryAccuracy | BinaryMatthewsCorrCoef | BinaryAUROC | loss  | epoch | train |
|----------------|------------------------|-------------|-------|-------|-------|
| 0.507          | -0.002                 | 0.498       | 0.713 | 0     | train |
| 0.524          | 0.010                  | 0.524       | 0.691 | 0     | eval  |

</div>

``` python
astats.color_dim()
```

![](index_files/figure-commonmark/cell-28-output-1.png)

``` python
astats.plot_stats()
```

![](index_files/figure-commonmark/cell-29-output-1.png)

``` python
astats.dead_chart()
```

![](index_files/figure-commonmark/cell-30-output-1.png)
