Metadata-Version: 1.2
Name: biotite
Version: 0.26.0
Summary: A comprehensive library for computational molecular biology
Home-page: https://www.biotite-python.org
Author: The Biotite contributors
License: BSD 3-Clause
Project-URL: Documentation, https://biotite.biotite-python.org
Project-URL: Repository, https://github.com/biotite-dev/biotite
Description: .. image:: https://img.shields.io/pypi/v/biotite.svg
           :target: https://pypi.python.org/pypi/biotite
           :alt: Biotite at PyPI
        .. image:: https://img.shields.io/pypi/pyversions/biotite.svg
           :alt: Python version
        .. image:: https://img.shields.io/travis/biotite-dev/biotite.svg
           :target: https://travis-ci.org/biotite-dev/biotite
           :alt: Travis CI status
        
        .. image:: https://www.biotite-python.org/_static/assets/general/biotite_logo_m.png
           :alt: The Biotite Project
        
        Biotite project
        ===============
        
        *Biotite* is your Swiss army knife for bioinformatics.
        Whether you want to identify homologous sequence regions in a protein family
        or you would like to find disulfide bonds in a protein structure: *Biotite*
        has the right tool for you.
        This package bundles popular tasks in computational molecular biology
        into a uniform *Python* library.
        It can handle a major part of the typical workflow
        for sequence and biomolecular structure data:
           
           - Searching and fetching data from biological databases
           - Reading and writing popular sequence/structure file formats
           - Analyzing and editing sequence/structure data
           - Visualizing sequence/structure data
           - Interfacing external applications for further analysis
        
        *Biotite* internally stores most of the data as *NumPy* `ndarray` objects,
        enabling
        
           - fast C-accelerated analysis,
           - intuitive usability through *NumPy*-like indexing syntax,
           - extensibility through direct access of the internal *NumPy* arrays.
        
        As a result the user can skip writing code for basic functionality (like
        file parsers) and can focus on what their code makes unique - from
        small analysis scripts to entire bioinformatics software packages.
        
        If you use *Biotite* in a scientific publication, please cite:
        
        | Kunzmann, P. & Hamacher, K. BMC Bioinformatics (2018) 19:346.
        | `<https://doi.org/10.1186/s12859-018-2367-z>`_
        
        
        Installation
        ------------
        
        *Biotite* requires the following packages:
        
           - **numpy**
           - **requests**
           - **msgpack**
        
        Some functions require some extra packages:
        
           - **mdtraj** - Required for trajetory file I/O operations.
           - **matplotlib** - Required for plotting purposes.
        
        *Biotite* can be installed via *Conda*...
        
        .. code-block:: console
        
           $ conda install -c conda-forge biotite
        
        ... or *pip*
        
        .. code-block:: console
        
           $ pip install biotite
        
        
        Usage
        -----
        
        Here is a small example that downloads two protein sequences from the
        *NCBI Entrez* database and aligns them:
        
        .. code-block:: python
        
           import biotite.sequence.align as align
           import biotite.sequence.io.fasta as fasta
           import biotite.database.entrez as entrez
        
           # Download FASTA file for the sequences of avidin and streptavidin
           file_name = entrez.fetch_single_file(
               uids=["CAC34569", "ACL82594"], file_name="sequences.fasta",
               db_name="protein", ret_type="fasta"
           )
        
           # Parse the downloaded FASTA file
           # and create 'ProteinSequence' objects from it
           fasta_file = fasta.FastaFile.read(file_name)
           avidin_seq, streptavidin_seq = fasta.get_sequences(fasta_file).values()
        
           # Align sequences using the BLOSUM62 matrix with affine gap penalty
           matrix = align.SubstitutionMatrix.std_protein_matrix()
           alignments = align.align_optimal(
               avidin_seq, streptavidin_seq, matrix,
               gap_penalty=(-10, -1), terminal_penalty=False
           )
           print(alignments[0])
        
        .. code-block::
        
           MVHATSPLLLLLLLSLALVAPGLSAR------KCSLTGKWDNDLGSNMTIGAVNSKGEFTGTYTTAV-TA
           -------------------DPSKESKAQAAVAEAGITGTWYNQLGSTFIVTA-NPDGSLTGTYESAVGNA
        
           TSNEIKESPLHGTQNTINKRTQPTFGFTVNWKFS----ESTTVFTGQCFIDRNGKEV-LKTMWLLRSSVN
           ESRYVLTGRYDSTPATDGSGT--ALGWTVAWKNNYRNAHSATTWSGQYV---GGAEARINTQWLLTSGTT
        
           DIGDDWKATRVGINIFTRLRTQKE---------------------
           -AANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
        
        More documentation, including a tutorial, an example gallery and the API
        reference is available at `<https://www.biotite-python.org/>`_.
        
        
        Contribution
        ------------
        
        Interested in improving *Biotite*?
        Have a look at the
        `contribution guidelines <https://www.biotite-python.org/contribute.html>`_.
        Feel free to join or community chat on `Discord <https://discord.gg/cUjDguF>`_.
        
Platform: UNKNOWN
Classifier: Development Status :: 4 - Beta
Classifier: Intended Audience :: Developers
Classifier: Intended Audience :: Science/Research
Classifier: License :: OSI Approved :: BSD License
Classifier: Natural Language :: English
Classifier: Operating System :: POSIX :: Linux
Classifier: Operating System :: MacOS
Classifier: Operating System :: Microsoft :: Windows
Classifier: Programming Language :: Python :: 3
Classifier: Programming Language :: Python :: Implementation :: CPython
Classifier: Topic :: Scientific/Engineering :: Bio-Informatics
Requires-Python: >=3.6
