Metadata-Version: 2.1
Name: bio-transformers
Version: 0.0.5
Summary: Wrapper on top of ESM/Protbert model in order to easily work with protein embedding
Home-page: UNKNOWN
Author: Instadeep
Author-email: a.delfosse@instadeep.com
License: Apache-2.0
Description: <p align="center">
          <img width="50%" src="./.source/_static/deepchain.png">
        </p>
        
        
        ![PyPI](https://img.shields.io/pypi/v/bio-transformers)
        [![License](https://img.shields.io/badge/License-Apache%202.0-blue.svg)](https://opensource.org/licenses/Apache-2.0)
        [![Python 3.7](https://img.shields.io/badge/python-3.7-blue.svg)](https://www.python.org/downloads/release/python-360/)
        [![Code style: black](https://img.shields.io/badge/code%20style-black-000000.svg)](https://github.com/psf/black)
        ![Dependencies](https://img.shields.io/badge/dependencies-up%20to%20date-brightgreen.svg)
        
        <details><summary>Table of contents</summary>
        
        - [Description](#bio-transformers)
        - [Installation](#Installation)
        - [Usage](#usage)
          - [Quick Start](#quickstart)
          - [Compute embeddings](#embeddings)
          - [Pseudo-Loglikelihood](#pseudo-loglikelihood)
        - [Roadmap](#roadmap)
        - [Citations](#citations)
        - [License](#license)
        </details>
        
        # Bio-transformers
        bio-transformers is a python wrapper on top of the **ESM/Protbert** model, which are **Transformers protein language model**, trained on millions on proteins and used to predict embeddings.
        This package provide other functionalities (like compute the loglikelihood of a protein) or compute embeddings on multiple-gpu.
        
         You can find the original repo here :
         - [ESM](https://github.com/facebookresearch/esm/)
         - [Protbert](https://github.com/agemagician/ProtTrans)
        
        ## Installation
        It is recommended to work with conda environnements in order to manage the specific dependencies of the package.
        ```bash
          conda create --name bio-transformers python=3.7 -y
          conda activate bio-transformers
          pip install bio-transformers
        ```
        # Usage
        
        ## Quick start
        The main class ```BioTranformers``` allow the developper to use Protbert and ESM backend
        
        ```
        >>from biotransformers import BioTransformers
        >>BioTransformers.list_backend()
        Use backend in this list :
        
          *   esm1_t34_670M_UR100
          *   esm1_t6_43M_UR50S
          *   esm1b_t33_650M_UR50S
          *   esm_msa1_t12_100M_UR50S
          *   protbert
          *   protbert_bfd
        
        ```
        
        ## Embeddings
        Choose a backend and pass a list of sequences of Amino acids to compute the embeddings.
        By default, the ```compute_embeddings``` function return the ```<CLS>``` token embedding.
        You can add a ```pooling_list``` in addition , so you can compute the mean of the tokens embeddings.
        
        ```
        from biotransformers import BioTransformers
        
        sequences = [
                "MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG",
                "KALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLQEE",
            ]
        
        bio_trans = BioTransformers(backend="protbert")
        embeddings = bio_trans.compute_embeddings(sequences, pooling_list=['mean'])
        
        cls_emb = embeddings['cls']
        mean_emb = embeddings['mean']
        ```
        
        ## Pseudo-Loglikelihood
        The protein loglikelihood is a metric which estimates the joint probability of observing a given sequence of amino-acids. The idea behind such an estimator is to approximate the probability that a mutated protein will be “natural”, and can effectively be produced by a cell.
        
        These metrics rely on transformers language models . These models are trained to predict a “masked” amino-acid in a sequence. As a consequence, they can provide us an estimate of the probability of observing an amino-acid given the “context” (the surrounding amino-acids).  By multiplying individual probabilities computed for a given amino-acid given its context, we obtain a pseudo-likelihood, which can be a candidate estimator to approximate a sequence stability.
        ```
        from biotransformers import BioTransformers
        
        sequences = [
                "MKTVRQERLKSIVRILERSKEPVSGAQLAEELSVSRQVIVQDIAYLRSLGYNIVATPRGYVLAGG",
                "KALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEEHLKALARKGVIEIVSGASRGIRLLQEE",
            ]
        
        bio_trans = BioTransformers(backend="protbert",device="cuda:0")
        loglikelihood = bio_trans.compute_loglikelihood(sequences)
        ```
        
        # Roadmap:
          - Support multi-gpu forward
          - support MSA transformers
          - add compute_accuracy functionnality
          - support finetuning of model
        
        # Citations
        
        # License
        
        This source code is licensed under the **Apache 2** license found in the `LICENSE` file in the root directory.
        
Platform: UNKNOWN
Classifier: License :: OSI Approved :: Apache Software License
Classifier: Operating System :: OS Independent
Classifier: Programming Language :: Python :: 3.7
Classifier: Topic :: Scientific/Engineering :: Artificial Intelligence
Classifier: Topic :: Scientific/Engineering :: Bio-Informatics
Classifier: Topic :: Software Development
Requires-Python: >=3.7
Description-Content-Type: text/markdown
